Share to:

ADI1

ADI1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4QGN

Identifikatori
AliasiADI1
Vanjski ID-jeviOMIM: 613400 MGI: 2144929 HomoloGene: 75081 GeneCards: ADI1
Lokacija gena (miš)
Hromosom 12 (miš)
Hrom.Hromosom 12 (miš)[1]
Hromosom 12 (miš)
Genomska lokacija za ADI1
Genomska lokacija za ADI1
Bend12|12 A2Početak28,725,230 bp[1]
Kraj28,732,174 bp[1]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
dioxygenase activity
vezivanje iona metala
oxidoreductase activity
acireductone dioxygenase [iron(II)-requiring activity]
iron ion binding
Ćelijska komponenta citosol
membrana
ćelijska membrana
jedro
citoplazma
Biološki proces methionine biosynthetic process
cellular amino acid biosynthetic process
L-methionine salvage from methylthioadenosine
methionine metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001306077
NM_018269

NM_134052

RefSeq (bjelančevina)

NP_001293006
NP_060739

NP_598813

Lokacija (UCSC)n/aChr 12: 28.73 – 28.73 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

ADI1 je enzim 1,2-dihidroksi-3-keto-5-metoltiopenten- dioksdigenaza koja je kod ljudi kodirana istoimenim genom sa hromosoma 2.[4][5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 179 aminokiselina, a molekulska težina 214,98 Da.[7]

1020304050
MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDP
ELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILD
GSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFV
GEPVWTAYNRPADHFEARGQYVKFLAQTA

Funkcija

Enzim pripada porodici enzima koji vezuju metal aci-redukton dioksigenaza, uključenih u spasavanje metionina. Ovaj enzim može regulisati procesiuranje iRNK u jedru i može obavljati različite funkcije ovisno o svojoj lokalizaciji.

Klinički značaj

Bolesti povezane s ADI1 uključuju Klebsiella i refuzumsku bolest.

ADI1 je sposoban da podrži replikaciju virusa hepatitisa C u inače nepermisivnoj ćelijskoj liniji.[8] Mouse hepatoma cells coexpressing human CD81 and ADI1/Sip-L supported HCV infection and replication.[9] Human ADI1//Sip-L over-expression in 293 cells enhances cell entry but not replication of HCV.[10][11]

Reference

  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020629 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ Uekita T, Gotoh I, Kinoshita T, Itoh Y, Sato H, Shiomi T, Okada Y, Seiki M (Mar 2004). "Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein-1 is a new member of the Cupin superfamily. A possible multifunctional protein acting as an invasion suppressor down-regulated in tumors". J Biol Chem. 279 (13): 12734–43. doi:10.1074/jbc.M309957200. PMID 14718544.
  5. ^ Hirano W, Gotoh I, Uekita T, Seiki M (Jun 2005). "Membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1 (MTCBP-1) acts as an eukaryotic aci-reductone dioxygenase (ARD) in the methionine salvage pathway". Genes Cells. 10 (6): 565–74. doi:10.1111/j.1365-2443.2005.00859.x. PMID 15938715. S2CID 25563839.
  6. ^ "Entrez Gene: ADI1 acireductone dioxygenase 1".
  7. ^ "UniProt, Q9BV57" (jezik: engleski). Pristupljeno 10. 11. 2021.
  8. ^ Yeh CT, Lai HY, Chen TC, Chu CM, Liaw YF (2001). "Identification of a hepatic factor capable of supporting hepatitis C virus replication in a nonpermissive cell line". J. Virol. 75 (22): 11017–24. doi:10.1128/JVI.75.22.11017-11024.2001. PMC 114682. PMID 11602742.
  9. ^ Yeh CT, Lai HY, Yeh YJ, Cheng JC (2008). "Hepatitis C virus infection in mouse hepatoma cells co-expressing human CD81 and Sip-L". Biochem Biophys Res Commun. 372 (1): 157–61. doi:10.1016/j.bbrc.2008.05.018. PMID 18474223.
  10. ^ Cheng JC, Yeh YJ, Pai LM, Chang ML, Yeh CT (2009). "293 cells over-expressing human ADI1 and CD81 are permissive for serum-derived hepatitis C virus infection". J. Med. Virol. 81 (9): 1560–8. doi:10.1002/jmv.21495. PMID 19626614. S2CID 27972307.
  11. ^ Hwang DR, Lai HY, Chang ML, Hsu JT, Yeh CT (2005). "Emergence of mutation clusters in the HCV genome during sequential viral passages in Sip-L expressing cells". J Virol Methods. 129 (2): 170–7. doi:10.1016/j.jviromet.2005.05.026. PMID 16005986.

Dopunska literatura

Vanjski linovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya