Share to:

ADM2

ADM2
Identifikatori
AliasiADM2
Vanjski ID-jeviOMIM: 608682 MGI: 2675256 HomoloGene: 49801 GeneCards: ADM2
Lokacija gena (čovjek)
Hromosom 22 (čovjek)
Hrom.Hromosom 22 (čovjek)[1]
Hromosom 22 (čovjek)
Genomska lokacija za ADM2
Genomska lokacija za ADM2
Bend22q13.33Početak50,481,543 bp[1]
Kraj50,486,440 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za ADM2
Genomska lokacija za ADM2
Bend15|15 E3Početak89,206,923 bp[2]
Kraj89,208,934 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija hormone activity
GO:0032403 protein-containing complex binding
Ćelijska komponenta extracellular region
intracellular anatomical structure
Biološki proces varenje
protein phosphorylation
GO:1901313 positive regulation of gene expression
adenylate cyclase-activating G protein-coupled receptor signaling pathway
Angiogeneza
ponašanje pri hranjenju
positive regulation of angiogenesis
negative regulation of blood pressure
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_024866
NM_001253845
NM_001369882

NM_182928

RefSeq (bjelančevina)

NP_001240774
NP_001356811

NP_891558

Lokacija (UCSC)Chr 22: 50.48 – 50.49 MbChr 15: 89.21 – 89.21 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

ADM2 jest protein koji je kod ljudi kodiran genom ADM2 sa hromosoma 22.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 148 aminokiselina, a molekulska težina 15.865 Da.

1020304050
MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQP
RHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRR
TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

Funkcija

ADM2 pripada porodici kalcitoninskih (MIM 114130) povezanih peptidnih hormona važnih za regulaciju različitih fizioloških funkcija i hemijskog sastava tečnosti i tkiva (prema OMIM[6])

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000128165 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000054136 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Takei Y, Inoue K, Ogoshi M, Kawahara T, Bannai H, Miyano S (Jan 2004). "Identification of novel adrenomedullin in mammals: a potent cardiovascular and renal regulator". FEBS Lett. 556 (1–3): 53–8. doi:10.1016/S0014-5793(03)01368-1. PMID 14706825. S2CID 2063665.
  6. ^ a b "Entrez Gene: ADM2 adrenomedullin 2".


Dopumska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya