Share to:

ASAH1

ASAH1
Identifikatori
AliasiASAH1
Vanjski ID-jeviOMIM: 613468 MGI: 1277124 HomoloGene: 10504 GeneCards: ASAH1
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za ASAH1
Genomska lokacija za ASAH1
Bend8p22Početak18,055,992 bp[1]
Kraj18,084,998 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za ASAH1
Genomska lokacija za ASAH1
Bend8|8 A4Početak41,793,234 bp[2]
Kraj41,827,810 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija N-acylsphingosine amidohydrolase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
ceramidase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Ćelijska komponenta Lizozom
lysosomal lumen
Egzosom
extracellular region
Vanćelijsko
tertiary granule lumen
ficolin-1-rich granule lumen
early endosome
Endoplazmatski retikulum
jedro
citoplazma
Biološki proces glycosphingolipid metabolic process
ceramide metabolic process
lipid metabolism
neutrophil degranulation
sphingosine biosynthetic process
ceramide biosynthetic process
ceramide catabolic process
keratinocyte differentiation
regulation of steroid biosynthetic process
regulation of programmed necrotic cell death
cellular response to tumor necrosis factor
sphingolipid metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001127505
NM_004315
NM_177924
NM_001363743

NM_019734

RefSeq (bjelančevina)

NP_001120977
NP_004306
NP_808592
NP_001350672

NP_062708

Lokacija (UCSC)Chr 8: 18.06 – 18.08 MbChr 8: 41.79 – 41.83 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Gen ASAH1 kod ljudi kodira enzim kiselu keramidazu.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 395 aminokiselina, а molekulska težina 44.660 Da.[8]

1020304050
MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY
TINLDLPPYKRWHELMLDKAPVLKVIVNSLKNMINTFVPSGKIMQVVDEK
LPGLLGNFPGPFEEEMKGIAAVTDIPLGEIISFNIFYELFTICTSIVAED
KKGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
ASSFAGYVGMLTGFKPGLFSLTLNERFSINGGYLGILEWILGKKDVMWIG
FLTRTVLENSTSYEEAKNLLTKTKILAPAYFILGGNQSGEGCVITRDRKE
SLDVYELDAKQGRWYVVQTNYDRWKHPFFLDDRRTPAKMCLNRTSQENIS
FETMYDVLSTKPVLNKLTVYTTLIDVTKGQFETYLRDCPDPCIGW

Funkcija

Ovaj gen kodira protein heterodimerni protein koji se sastoji od neglikozilirane podjedinice alfa i glikozilirane podjedinice beta koja se posttranslacijski cijepa na zreli enzim. Kodirani protein katalizira sintezu i razgradnju keramida u sfingozin i masnu kiselinu. Mutacije u ovom genu povezane su s poremećajem lizosomnog skladištenja, poznatim kao Farberova bolest, a odnedavno i s rijetkim neurodegenerativnim stanjem poznatim kao spinalna mišićna atrofija s progresivnom mioklonskom epilepsijom.[9] Two transcript variants encoding distinct isoforms have been identified for this gene.[7] U melanocitnim ćelijama ekspresija ASAH1 gena može se regulirati MITF-om.[10]

Kao cilj lijeka za glioblastom

Ekspresija ASAH1 je pojačano regulirana nakon zračenja, što sugerira da ima ulogu u davanju radiootpornosti na glioblastom i u razvoju rekurentnog glioblastoma.[11] Inhibicija aktivnosti ASAH1 s carmofurom, lijekom koji je odobren za kliničko liječenje kolorektumskog karcinoma u nekoliko zemalja, dovodi do značajne smrti ćelija i kao rezultat toga je predložena kao meta lijeka u liječenje glioblastoma.[12] Također je predloženo da bude nova meta lijekova i za dječje tumore mozga.[13]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000104763 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031591 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Koch J, Gärtner S, Li CM, Quintern LE, Bernardo K, Levran O, Schnabel D, Desnick RJ, Schuchman EH, Sandhoff K (decembar 1996). "Molecular cloning and characterization of a full-length complementary DNA encoding human acid ceramidase. Identification Of the first molecular lesion causing Farber disease". The Journal of Biological Chemistry. 271 (51): 33110–5. doi:10.1074/jbc.271.51.33110. PMID 8955159.
  6. ^ Li CM, Park JH, He X, Levy B, Chen F, Arai K, Adler DA, Disteche CM, Koch J, Sandhoff K, Schuchman EH (decembar 1999). "The human acid ceramidase gene (ASAH): structure, chromosomal location, mutation analysis, and expression". Genomics. 62 (2): 223–31. doi:10.1006/geno.1999.5940. PMID 10610716.
  7. ^ a b "Entrez Gene: ASAH1 N-acylsphingosine amidohydrolase (acid ceramidase) 1".
  8. ^ "UniProt, Q13510". Pristupljeno 13. 9. 2021.
  9. ^ Zhou J, Tawk M, Tiziano FD, Veillet J, Bayes M, Nolent F, Garcia V, Servidei S, Bertini E, Castro-Giner F, Renda Y, Carpentier S, Andrieu-Abadie N, Gut I, Levade T, Topaloglu H, Melki J (juli 2012). "Spinal muscular atrophy associated with progressive myoclonic epilepsy is caused by mutations in ASAH1". American Journal of Human Genetics. 91 (1): 5–14. doi:10.1016/j.ajhg.2012.05.001. PMC 3397266. PMID 22703880.
  10. ^ Hoek KS, Schlegel NC, Eichhoff OM, Widmer DS, Praetorius C, Einarsson SO, Valgeirsdottir S, Bergsteinsdottir K, Schepsky A, Dummer R, Steingrimsson E (decembar 2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell & Melanoma Research. 21 (6): 665–76. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971. S2CID 24698373.
  11. ^ Doan NB, Nguyen HS, Al-Gizawiy MM, Mueller WM, Sabbadini RA, Rand SD, Connelly JM, Chitambar CR, Schmainda KM, Mirza SP (oktobar 2017). "Acid ceramidase confers radioresistance to glioblastoma cells". Oncology Reports. 38 (4): 1932–40. doi:10.3892/or.2017.5855. PMC 5652937. PMID 28765947.
  12. ^ Doan NB, Alhajala H, Al-Gizawiy MM, Mueller WM, Rand SD, Connelly JM, Cochran EJ, Chitambar CR, Clark P, Kuo J, Schmainda KM, Mirza SP (decembar 2017). "Acid ceramidase and its inhibitors: a de novo drug target and a new class of drugs for killing glioblastoma cancer stem cells with high efficiency". Oncotarget. 8 (68): 112662–74. doi:10.18632/oncotarget.22637. PMC 5762539. PMID 29348854.
  13. ^ Doan NB, Nguyen HS, Montoure A, Al-Gizawiy MM, Mueller WM, Kurpad S, Rand SD, Connelly JM, Chitambar CR, Schmainda KM, Mirza SP (april 2017). "Acid ceramidase is a novel drug target for pediatric brain tumors". Oncotarget. 8 (15): 24753–61. doi:10.18632/oncotarget.15800. PMC 5421885. PMID 28445970.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya