Share to:

ATRAID

ATRAID
Identifikatori
AliasiATRAID
Vanjski ID-jeviMGI: 1918918 HomoloGene: 15412 GeneCards: ATRAID
Lokacija gena (čovjek)
Hromosom 2 (čovjek)
Hrom.Hromosom 2 (čovjek)[1]
Hromosom 2 (čovjek)
Genomska lokacija za ATRAID
Genomska lokacija za ATRAID
Bend2p23.3Početak27,212,041 bp[1]
Kraj27,217,178 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za ATRAID
Genomska lokacija za ATRAID
Bend5|5 B1Početak31,205,656 bp[2]
Kraj31,211,967 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
molekularna funkcija
Ćelijska komponenta perinuklearno područje citoplazme
integral component of membrane
lysosomal membrane
ćelijska membrana
nuclear envelope
membrana
jedro
Biološki proces Regulacija ekspresije gena
negative regulation of osteoblast proliferation
Ćelijska diferencijacija
positive regulation of osteoblast differentiation
positive regulation of bone mineralization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_080592
NM_001170795
NM_016085

NM_027855
NM_212470

RefSeq (bjelančevina)

NP_001164266
NP_057169

NP_082131
NP_997635

Lokacija (UCSC)Chr 2: 27.21 – 27.22 MbChr 5: 31.21 – 31.21 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Apoptozno vezani protein 3 jest protein koji je kod ljudi kodiran genom ATRAID sa hromosoma 2.[5][6][7]

Amiokiselininska sekvenca

Dužina polipeptidnog lanca je 229 aminokiselina, a molkekulska iežina 24.747 Da.[8]

1020304050
MAPHDPGSLTTLVPWAAALLLALGVERALALPEICTQCPGSVQNLSKVAF
YCKTTRELMLHARCCLNQKGTILGLDLQNCSLEDPGPNFHQAHTTVIIDL
QANPLKGDLANTFRGFTQLQTLILPQHVNCPGGINAWNTITSYIDNQICQ
GQKNLCNNTGDPEMCPENGSCVPDGPGLLQCVCADGFHGYKCMRQGSFSL
LMFFGILGATTLSVSILLWATQRRKAKTS

Funkcija

Smatra se da je ovaj gen uključen u apoptozu, a također može biti uključen u hematopoetski razvoj i diferencijaciju. Za ovaj gen pronađene su dvije alternativno prerađene varijante transkripta koje kodiraju različite izoforme.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000138085 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000013622 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z (Nov 2000). "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells". Genome Res. 10 (10): 1546–60. doi:10.1101/gr.140200. PMC 310934. PMID 11042152.
  6. ^ Zhu F, Yan W, Zhao ZL, Chai YB, Lu F, Wang Q, Peng WD, Yang AG, Wang CJ (Nov 2000). "Improved PCR-based subtractive hybridization strategy for cloning differentially expressed genes". BioTechniques. 29 (2): 310–3. doi:10.2144/00292st06. PMID 10948432.
  7. ^ a b "Entrez Gene: C2orf28 chromosome 2 open reading frame 28".
  8. ^ "UniProt, Q6UW56" (jezik: engleski). Pristupljeno 11. 11. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya