Share to:

CGGBP1

CGGBP1
Identifikatori
AliasiCGGBP1
Vanjski ID-jeviOMIM: 603363 MGI: 2146370 HomoloGene: 2718 GeneCards: CGGBP1
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za CGGBP1
Genomska lokacija za CGGBP1
Bend3p11.1Početak88,051,944 bp[1]
Kraj88,149,885 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za CGGBP1
Genomska lokacija za CGGBP1
Bend16|16 C1.3Početak64,672,359 bp[2]
Kraj64,679,870 bp[2]
Ontologija gena
Molekularna funkcija vezivanje sa DNK
RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001948, GO:0016582 vezivanje za proteine
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
double-stranded DNA binding
vezivanje identičnih proteina
Ćelijska komponenta jedro
nukleoplazma
Biološki proces GO:0009373 regulation of transcription, DNA-templated
GO:1901227 negative regulation of transcription by RNA polymerase II
transcription, DNA-templated
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001008390
NM_001195308
NM_003663

NM_178647
NM_001357416

RefSeq (bjelančevina)

NP_001008391
NP_001182237
NP_003654

NP_848762
NP_001344345

Lokacija (UCSC)Chr 3: 88.05 – 88.15 MbChr 16: 64.67 – 64.68 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

CGG tripletni protein 1 vezan za ponavljanje jest protein koji je kod ljudi kodiran genom CGGBP1 sa hromosoma 3.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 167 aminokiselina, а molekulska težina 18.820 Da.[8]

1020304050
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVL
NHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEK
VSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAY
LPDGYENENQLLNSQDC

Funkcija

Postojanje CGG-vezujućeg faktora je prepoznato od 1990. godine, a protein su identificirali Deissler i kolege 1997. godine. Ima 167 aminokiselina i masu od 20 kDa i uključuje DNK -vezujući domen C2H2 cinkovog prsta. Ljudski gen nalazi se na hromosomu 3, na poziciji 3p11.1, odmah pored centromere, gdje ima četiri poznata promotora. Čini se da je CGGBP1 evoluirao iz hAT transpozona i nalazi se u svim amniotima.[9]

Protein se vezuje za trinukleotidno ponavljanje CGG, da bi regulirao transkripciju (uključujući inhibiciju Alu elementa) i translaciju. Neophodan je za opstanak ćelija, jer ima široke citoprotektivne funkcije uključujući popravak DNK i održavanje telomera. Budući da promotori gena uključuju ponavljanja CGG, on je samoregulirajući.[9]

CGGBP1 utiče na ekspresiju gena fragilnog X za mentalno zaostajanje, FMR1, specifičnom interakcijom sa CGG trinukleotidnim ponavljanjem u njegovom 5-prim UTR-u, neprevedenom regulatornom regionu uzvodno od kodirajuće sekvence gena.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000163320 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000054604 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Deissler H, Wilm M, Genc B, Schmitz B, Ternes T, Naumann F, Mann M, Doerfler W (Jul 1997). "Rapid protein sequencing by tandem mass spectrometry and cDNA cloning of p20-CGGBP. A novel protein that binds to the unstable triplet repeat 5'-d(CGG)n-3' in the human FMR1 gene". J Biol Chem. 272 (27): 16761–8. doi:10.1074/jbc.272.27.16761. PMID 9201980.
  6. ^ Naumann F, Remus R, Schmitz B, Doerfler W (Dec 2003). "Gene structure and expression of the 5'-(CGG)(n)-3'-binding protein (CGGBP1)". Genomics. 83 (1): 106–18. doi:10.1016/S0888-7543(03)00212-X. PMID 14667814.
  7. ^ a b "Entrez Gene: CGGBP1 CGG triplet repeat binding protein 1".
  8. ^ "UniProt, Q9UFW8" (jezik: engleski). Pristupljeno 2. 11. 2021.
  9. ^ a b Singh, Umashankar; Westermark, Bengt (2015). "CGGBP1--an indispensable protein with ubiquitous cytoprotective functions". Upsala Journal of Medical Sciences. 120 (4): 219–232. doi:10.3109/03009734.2015.1086451. PMC 4816882. PMID 26482656.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya