Share to:

CHMP1B

CHMP1B
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3EAB, 4TXQ, 4TXR, 3JC1

Identifikatori
AliasiCHMP1B
Vanjski ID-jeviOMIM: 606486 MGI: 1914314 HomoloGene: 41374 GeneCards: CHMP1B
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za CHMP1B
Genomska lokacija za CHMP1B
Bend18p11.21Početak11,851,413 bp[1]
Kraj11,854,444 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za CHMP1B
Genomska lokacija za CHMP1B
Bend18|18 E1Početak67,338,437 bp[2]
Kraj67,340,960 bp[2]
Ontologija gena
Molekularna funkcija protein domain specific binding
GO:0001948, GO:0016582 vezivanje za proteine
vezivanje identičnih proteina
Ćelijska komponenta citoplazma
ESCRT III complex
citosol
endozom
late endosome membrane
membrana
membrane coat
endosome membrane
Egzosom
jedro
midbody
multivesicular body
Biološki proces regulation of centrosome duplication
nucleus organization
establishment of protein localization
multivesicular body assembly
regulation of mitotic spindle assembly
Ćelijska dioba
protein transport
ćelijski ciklus
septum digestion after cytokinesis
mitotic metaphase plate congression
vacuolar transport
ESCRT III complex disassembly
GO:0015915 transport
viral budding via host ESCRT complex
endosome transport via multivesicular body sorting pathway
late endosome to vacuole transport
midbody abscission
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_020412

NM_024190

RefSeq (bjelančevina)

NP_065145

NP_077152

Lokacija (UCSC)Chr 18: 11.85 – 11.85 MbChr 18: 67.34 – 67.34 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Napunjeni viševezikulski tjelesni protein 1b je protein koji je kod ljudi kodiran genom CHMP1B.[5][6]

Dužina polipeptidnog lanca je 199 aminokiselina, a molekulska težina — 22.109[7].

Aminokiselinska sekvenca

Simboli

C: Cistein
D: Asparaginska kiselina
E: Glutaminska kiselina
F: Fenilalanin
G: Glicin
H: Histidin
I: Izoleucin
K: Lizin
L: Leucin
M: Metionin
N: Asparagin
P: Prolin
Q: Glutamin
R: Arginin
S: Serin
T: Treonin
V: Valin
W: Triptofan
Y: Tirozin

1020304050
MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARI
HAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMD
ATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVD
MLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000255112 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000109901 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Reid E, Connell J, Edwards TL, Duley S, Brown SE, Sanderson CM (Dec 2004). "The hereditary spastic paraplegia protein spastin interacts with the ESCRT-III complex-associated endosomal protein CHMP1B". Hum Mol Genet. 14 (1): 19–38. doi:10.1093/hmg/ddi003. PMID 15537668.
  6. ^ "Entrez Gene: CHMP1B chromatin modifying protein 1B".
  7. ^ "UniProt, Q7LBR1". Pristupljeno 12. 9. 2017.

Vanjski linkovi

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya