Share to:

CIDEB

CIDEB
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1D4B

Identifikatori
AliasiCIDEB
Vanjski ID-jeviOMIM: 604441 MGI: 1270844 HomoloGene: 7666 GeneCards: CIDEB
Lokacija gena (čovjek)
Hromosom 14 (čovjek)
Hrom.Hromosom 14 (čovjek)[1]
Hromosom 14 (čovjek)
Genomska lokacija za CIDEB
Genomska lokacija za CIDEB
Bend14q12Početak24,305,096 bp[1]
Kraj24,311,430 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za CIDEB
Genomska lokacija za CIDEB
Bend14|14 C3Početak55,991,507 bp[2]
Kraj55,995,915 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
vezivanje identičnih proteina
Ćelijska komponenta perinuklearno područje citoplazme
citosol
Lipidna kapljica
intracellular anatomical structure
Biološki proces positive regulation of release of cytochrome c from mitochondria
execution phase of apoptosis
activation of cysteine-type endopeptidase activity
positive regulation of cell death
intrinsic apoptotic signaling pathway in response to DNA damage
GO:0097285 apoptoza
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_014430
NM_001318807

NM_009894
NM_026804

RefSeq (bjelančevina)

NP_001305736
NP_055245

NP_034024

Lokacija (UCSC)Chr 14: 24.31 – 24.31 MbChr 14: 55.99 – 56 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Inducirajući efektor b ćelijske smrti sličan DFFA, znan i kao CIDEB, je ljudski gen.[5][6][7]

Nedavno je CIDEB nokaut-miševa generiran tehnikom homologne rekombinacije. CIDE nulti miševi pokazuju smanjenje lipogeneze. CIDEB nokaut- miševi otporni su na gojaznost i jetrenu steatozu izazvanu ishranom sa puno masnoća. Pored toga, nulti miševi CIDEB također imaju poboljšanu osetljivost na insulin i pojačan metabolizam jetrene oksidacije masnih kiselina i cijelog tela.[8]

Lugovskoy et al. (1999) izvijestili su o strukturi konzerviranog N-terminalnog domena (CIDE-N) ljudskog CIDEB. Pokazali su da CIDE-N domen CIDEB komunicira sa CIDE-N domenima i DFF40 i DFF45. Vezni epitopi bili su slični i locirani u visoko nabijenoj bipolarnoj površini CIDEB-a. Nadalje, pokazali su da CIDE-N domen CIDEB regulira enzimsku aktivnost kompleksa DFF40 / DFF45 in vitro.[9]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 219 aminokiselina, a molekulska težina 24.678 Da.[10]

1020304050
MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKG
LTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLM
VLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSL
NVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTL
RHAVEGAEQWQQKGRLHSY
Simboli

Kloniranje i ekspresija

Inohara et al. (1998) izvijestili su o identifikaciji i karakterizaciji dva sisarska gena, koje su nazvali CIDEA i CIDEB (efektori A i B slični DFFA-u koji induciraju ćelijsku smrt), kodirajući visoko povezane proteine s homologijom u N-terminalnom području DFF45, podjedinici faktora fragmentacije DNK (DFF) koja se za vrijeme apoptoze razlaže kaspazom-3 . Utvrđeno je da CIDEA i CIDEB aktiviraju apoptozu u ćelijama sisara, a to je inhibirano DFF45, ali ne i inhibitorima kaspaze. Izražavanje CIDEA-om inducirane fragmentacije DNK u T-ćelija]]ma 293, što je također inhibirao DFF45; to dalje sugerira da DFF45 inhibira apoptotske aktivnosti CIDE. Pored CIDEA i CIDEB sisara, Inohara et al. ](1998) identificirali su DREP1, [[homolog roda Drosophila DFF45, koji bi mogao inhibirati apoptozu posredovanu CIDEA.

Analiza mutacija otkrila je da je C-terminalna regija CIDEA neophodna i dovoljna za ubijanje ćelija, dok je region s homologijom DFF45 na N-terminalu potreban da DFF45 inhibira apoptozu izazvanu CIDEA-om. Apoptoza posredovana CD95/Fas poboljšana je CIDE-ima, ali inhibirana DFF45-om. Ova ispitivanja sugeriraju da je DFF45 evolucijski konzerviran i podrazumijeva CIDE kao efektore koji inhibiraju DFF45 za promoviranje ćelijske smrti i fragmentacije DNK.[11]

Reference

  1. ^ a b c ENSG00000285199 GRCh38: Ensembl release 89: ENSG00000136305, ENSG00000285199 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022219 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: CIDEB cell death-inducing effector b".
  6. ^ Ye, Jing; Zhong Li, John; Liu, Yang; Li, Xuanhe; Yang, Tianshu; Ma, Xiaodong; Li, Qing; Yao, Zemin; Li, Peng (2009). "Cideb, an ER- and Lipid Droplet-Associated Protein, Mediates VLDL Lipidation and Maturation by Interacting with Apolipoprotein B." Cell Metabolism. 9 (2): 177–190. doi:10.1016/j.cmet.2008.12.013. PMID 19187774.
  7. ^ Li, JZ; Lei, Y; Wang, Y; Zhang, Y; Ye, J; Xia, X; Pan, X; Li, P (maj 2010). "Control of cholesterol biosynthesis, uptake and storage in hepatocytes by Cideb". Biochim Biophys Acta. 1801 (5): 577–86. doi:10.1016/j.bbalip.2010.01.012. PMID 20123130.
  8. ^ Zhong Li, John; Ye, Jing; Xue, Bofu; Qi, Jingzong; Zhang, Jing; Zhou, Zhihong; Li, Qing; Wen, Zilong; Li, Peng (2007). /cgi/content/short/56/10/2523 "Cideb regulates diet-induced obesity, liver steatosis and insulin sensitivity by controlling lipogeneis and fatty acid oxidation" Provjerite vrijednost parametra |url= (pomoć). Diabetes. 56 (10): 2523–2532. doi:10.2337/db07-0040. PMID 17646209.
  9. ^ Lugovskoy, A. A., Zhou, P., Chou, J. J., McCarty, J. S., Li, P., Wagner, G. Solution structure of the CIDE-N domain of CIDE-B and a model for CIDE-N/CIDE-N interactions in the DNA fragmentation pathway of apoptosis. Cell 99: 747-755, 1999. PubMed: 10619428
  10. ^ "UniProt, Q9UHD4". Pristupljeno 22. 7. 2021.
  11. ^ Inohara, N., Koseki, T., Chen, S., Wu, X., Nunez, G. CIDE, a novel family of cell death activators with homology to the 45 kDa subunit of the DNA fragmentation factor. EMBO J. 17: 2526-2533, 1998. PubMed: 9564035

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya