Share to:

CREG1

CREG1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1XHN

Identifikatori
AliasiCREG1
Vanjski ID-jeviOMIM: 618055 MGI: 1344382 HomoloGene: 31199 GeneCards: CREG1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za CREG1
Genomska lokacija za CREG1
Bend1q24.2Početak167,529,117 bp[1]
Kraj167,553,805 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za CREG1
Genomska lokacija za CREG1
Bend1|1 H2.3Početak165,591,315 bp[2]
Kraj165,602,877 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija transcription factor binding
GO:0001106 transcription corepressor activity
Ćelijska komponenta Egzosom
transcription regulator complex
extracellular region
Vanćelijsko
azurophil granule lumen
Biološki proces GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
multicellular organism development
regulation of growth
Ćelijska proliferacija
GO:0009373 regulation of transcription, DNA-templated
negative regulation of nucleic acid-templated transcription
neutrophil degranulation
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003851

NM_011804

RefSeq (bjelančevina)

NP_003842

NP_035934

Lokacija (UCSC)Chr 1: 167.53 – 167.55 MbChr 1: 165.59 – 165.6 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein CREG1 (ćelijski represor E1A-stimuliranih gena 1) jest protein koji je kod ljudi kodiran genom CREG1 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 220 aminokiselina, a molekulska težina 24.075 Da.[7]

1020304050
MAGLSRGSARALLAALLASTLLALLVSPARGRGGRDHGDWDEASRLPPLP
PREDAARVARFVTHVSDWGALATISTLEAVRGRPFADVLSLSDGPPGAGS
GVPYFYLSPLQLSVSNLQENPYATLTMTLAQTNFCKKHGFDPQSPLCVHI
MLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVL
DYFGGPKIVTPEEYYNVTVQ

Funkcija

Protein adenovirusa E1A istovremeno aktivira i potiskuje ekspresiju gena, kako bi promovirao ćelijsku proliferaciju i inhibirao diferencijaciju. Protein kodiran ovim genom antagonizira transkripcijsku aktivaciju i ćelijsku transformaciju pomoću E1A. Ovaj protein dijeli ograničenu sličnost sekvence sa E1A i vezuje se za opći transkripcijski faktor TBP i tumorski supresor pRb in vitro. Ovaj gen može doprinijeti transkripcijskoj kontroli rasta i ćelijske diferencijacije.[6]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000143162 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000040713 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Veal E, Eisenstein M, Tseng ZH, Gill G (Sep 1998). "A Cellular Repressor of E1A-Stimulated Genes That Inhibits Activation by E2F". Mol Cell Biol. 18 (9): 5032–41. doi:10.1128/mcb.18.9.5032. PMC 109088. PMID 9710587.
  6. ^ a b "Entrez Gene: CREG1 cellular repressor of E1A-stimulated genes 1".
  7. ^ "UniProt, O75629" (jezik: en.). Pristupljeno 9. 12. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya