Share to:

DVL1

DVL1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1FSH, 1MC7, 2KAW, 3PZ8

Identifikatori
AliasiDVL1
Vanjski ID-jeviOMIM: 601365 MGI: 94941 HomoloGene: 20926 GeneCards: DVL1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za DVL1
Genomska lokacija za DVL1
Bend1p36.33Početak1,335,276 bp[1]
Kraj1,349,418 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za DVL1
Genomska lokacija za DVL1
Bend4 E2|4 87.61 cMPočetak155,931,859 bp[2]
Kraj155,943,760 bp[2]
Ontologija gena
Molekularna funkcija beta-catenin binding
GO:0005110 frizzled binding
GO:0001948, GO:0016582 vezivanje za proteine
vezivanje identičnih proteina
vezivanje enzima
protein kinase binding
Ćelijska komponenta citoplazma
citosol
Wnt signalosome
lateral plasma membrane
membrana
microtubule cytoskeleton
growth cone
ćelijska membrana
sinapsa
Akson
soma
dendrit
neuron projection
Mikrotubula
clathrin-coated vesicle
presynapse
dendritična kičma
GO:0097483, GO:0097481 postsynaptic density
GO:0016023 citoplazmatska vezikula
Schaffer collateral - CA1 synapse
glutamatergic synapse
Biološki proces regulation of protein phosphorylation
GO:0033128 negative regulation of protein phosphorylation
regulation of neurotransmitter levels
positive regulation of protein phosphorylation
GO:0007243 intracellular signal transduction
axonogenesis
negative regulation of protein kinase activity
dendrite morphogenesis
synapse organization
protein stabilization
Wnt-signalni put
transcription by RNA polymerase II
negative regulation of protein binding
receptor clustering
planar cell polarity pathway involved in neural tube closure
axon guidance
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
positive regulation of Wnt signaling pathway
multicellular organism development
Wnt signaling pathway, planar cell polarity pathway
protein localization to microtubule
neuromuscular junction development
cochlea morphogenesis
neural tube development
cytoplasmic microtubule organization
positive regulation of neuron projection development
axon extension
protein localization to nucleus
canonical Wnt signaling pathway
socijalno ponašanje
skeletal muscle acetylcholine-gated channel clustering
collateral sprouting
convergent extension involved in neural plate elongation
negative regulation of canonical Wnt signaling pathway
GO:0010554 neurotransmitter secretion
positive regulation of proteasomal ubiquitin-dependent protein catabolic process
convergent extension involved in organogenesis
prepulse inhibition
positive regulation of canonical Wnt signaling pathway
beta-catenin destruction complex disassembly
dendritic spine morphogenesis
positive regulation of excitatory postsynaptic potential
presynapse assembly
positive regulation of protein localization to presynapse
non-canonical Wnt signaling pathway
postsynapse organization
positive regulation of neuron projection arborization
regulation of synaptic vesicle exocytosis
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004421
NM_181870
NM_182779
NM_001330311

NM_010091
NM_001302342
NM_001356381

RefSeq (bjelančevina)

NP_001317240
NP_004412

NP_034221
NP_001343310

Lokacija (UCSC)Chr 1: 1.34 – 1.35 MbChr 4: 155.93 – 155.94 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Neuređeni homolog segmentne polarnosti proteina (DVL-1) jest protein koji je kod ljudi kodiran genom DVL1 sa hromosoma 1.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 695 aminokiselina, a molekulska težina 75.187 Da.[7]

1020304050
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFK
SMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHT
DLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARR
RNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGST
SRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIV
TVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVP
RADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPG
APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADV
VDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDL
CSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFP
PAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGS
GSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKA
YTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM

Funkcija

DVL1, ljudski homolog Drosophila gena neuređenog proteina (dsh) kodira citoplazmatski fosfoprotein koji reguliše ćelijsku proliferaciju, djelujući kao molekula transduktora za razvojne procese, uključujući segmentaciju i neuroblastne specifikacije. DVL1 je gen kandidat za procese uključene u transformacije ćelia u neuroblastomu. Schwartz-Jampelov sindrom i Charcot-Marie-Toothova bolest tip 2A mapirani su u istu regiju kao DVL1. Fenotipovi ovih bolesti mogu biti u skladu sa defektima koji se mogu očekivati od aberantne ekspresije DVL gena tokom razvoja. Za ovaj gen su pronađene tri varijante transkripta koje kodiraju tri različite izoforme.[6]

Interakcije

Pokazalo se da DVL1 ima interakcije sa:

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000107404 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029071 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Pizzuti A, Amati F, Calabrese G, Mari A, Colosimo A, Silani V, Giardino L, Ratti A, Penso D, Calzà L, Palka G, Scarlato G, Novelli G, Dallapiccola B (Jan 1997). "cDNA characterization and chromosomal mapping of two human homologues of the Drosophila dishevelled polarity gene". Hum Mol Genet. 5 (7): 953–8. doi:10.1093/hmg/5.7.953. PMID 8817329.
  6. ^ a b "Entrez Gene: DVL1 dishevelled, dsh homolog 1 (Drosophila)".
  7. ^ "UniProt, O14640" (jezik: engleski). Pristupljeno 24. 11. 2021.
  8. ^ Li L, Yuan H, Weaver CD, Mao J, Farr GH, Sussman DJ, Jonkers J, Kimelman D, Wu D (Aug 1999). "Axin and Frat1 interact with dvl and GSK, bridging Dvl to GSK in Wnt-mediated regulation of LEF-1". EMBO J. 18 (15): 4233–40. doi:10.1093/emboj/18.15.4233. PMC 1171499. PMID 10428961.
  9. ^ Kim MJ, Chia IV, Costantini F (Nov 2008). "SUMOylation target sites at the C terminus protect Axin from ubiquitination and confer protein stability". FASEB J. 22 (11): 3785–94. doi:10.1096/fj.08-113910. PMC 2574027. PMID 18632848.
  10. ^ Kishida S, Yamamoto H, Hino S, Ikeda S, Kishida M, Kikuchi A (Jun 1999). "DIX domains of Dvl and axin are necessary for protein interactions and their ability to regulate beta-catenin stability". Mol. Cell. Biol. 19 (6): 4414–22. doi:10.1128/mcb.19.6.4414. PMC 104400. PMID 10330181.
  11. ^ Inobe M, Katsube Ki, Miyagoe Y, Nabeshima Yi, Takeda S (Dec 1999). "Identification of EPS8 as a Dvl1-associated molecule". Biochem. Biophys. Res. Commun. 266 (1): 216–21. doi:10.1006/bbrc.1999.1782. PMID 10581192.
  12. ^ Warner DR, Pisano MM, Roberts EA, Greene RM (Mar 2003). "Identification of three novel Smad binding proteins involved in cell polarity". FEBS Lett. 539 (1–3): 167–73. doi:10.1016/s0014-5793(03)00155-8. PMID 12650946.

Dopunska literatura

Vanjski linkovi

  • DVL1 on the Atlas of Genetics and Cytogenetics in Oncology and Haematology

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya