Share to:

LEFTY1

LEFTY1
Identifikatori
AliasiLEFTY1
Vanjski ID-jeviOMIM: 603037 MGI: 107405 HomoloGene: 49231 GeneCards: LEFTY1
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za LEFTY1
Genomska lokacija za LEFTY1
Bend1q42.12Početak225,886,282 bp[1]
Kraj225,911,382 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za LEFTY1
Genomska lokacija za LEFTY1
Bend1|1 H4Početak180,762,587 bp[2]
Kraj180,765,965 bp[2]
Ontologija gena
Molekularna funkcija transforming growth factor beta receptor binding
cytokine activity
growth factor activity
Ćelijska komponenta extracellular region
Vanćelijsko
Biološki proces regulation of apoptotic process
multicellular organism development
positive regulation of pathway-restricted SMAD protein phosphorylation
heart morphogenesis
determination of left/right symmetry
GO:1901227 negative regulation of transcription by RNA polymerase II
transforming growth factor beta receptor signaling pathway
regulation of MAPK cascade
SMAD protein signal transduction
cell development
BMP signaling pathway
regulation of signaling receptor activity
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_020997

NM_010094

RefSeq (bjelančevina)

NP_066277

NP_034224

Lokacija (UCSC)Chr 1: 225.89 – 225.91 MbChr 1: 180.76 – 180.77 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Faktor 1 određenja lijevo-desno jest protein koji je kod ljudi kodiran genom LEFTY1 sa hromosoma 1.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 366 aminokiselina, a molekulska težina Da. 40.880 [6]

1020304050
MQPLWLCWALWVLPLASPGAALTGEQLLGSLLRQLQLKEVPTLDRADMEE
LVIPTHVRAQYVALLQRSHGDRSRGKRFSQSFREVAGRFLALEASTHLLV
FGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWL
RVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQ
VSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGD
CDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQP
PEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQK
CSCASDGALVPRRLQP

Funkcija

Ovaj gen kodira člana porodice proteina TGF-beta. Sličan izlučeni protein kod miša ima ulogu u određivanju asimetrije lijevo-desno u sistemima organa tokom razvoja. Alternativna prerada ovog proteina može dati tri različita izoformna proizvoda. Ovaj gen je usko povezan i sa srodnim članom porodice i sa srodnim pseudogenom.

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000243709 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000038793 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Left-right determination factor 1". Pristupljeno 3. 8. 2016.
  6. ^ "UniProt, O75610" (jezik: engleski). Pristupljeno 13. 12. 2021.

Dopunska literatura

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya