Share to:

LRG1

LRG1
Identifikatori
AliasiLRG1
Vanjski ID-jeviOMIM: 611289 MGI: 1924155 HomoloGene: 36468 GeneCards: LRG1
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za LRG1
Genomska lokacija za LRG1
Bend19p13.3Početak4,536,402 bp[1]
Kraj4,540,036 bp[1]
Lokacija gena (miš)
Hromosom 17 (miš)
Hrom.Hromosom 17 (miš)[2]
Hromosom 17 (miš)
Genomska lokacija za LRG1
Genomska lokacija za LRG1
Bend17 29.17 cM|17 DPočetak56,426,678 bp[2]
Kraj56,429,001 bp[2]
Ontologija gena
Molekularna funkcija transforming growth factor beta receptor binding
GO:0001948, GO:0016582 vezivanje za proteine
molekularna funkcija
Ćelijska komponenta Egzosom
membrana
Vanćelijsko
specific granule lumen
intracellular membrane-bounded organelle
tertiary granule lumen
ficolin-1-rich granule lumen
extracellular region
Biološki proces positive regulation of transforming growth factor beta receptor signaling pathway
positive regulation of endothelial cell proliferation
positive regulation of angiogenesis
brown fat cell differentiation
neutrophil degranulation
GO:0022610 biološki proces
response to bacterium
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_052972

NM_029796

RefSeq (bjelančevina)

NP_443204

NP_084072

Lokacija (UCSC)Chr 19: 4.54 – 4.54 MbChr 17: 56.43 – 56.43 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Leucinom bogati alfa-2-glikoprotein 1 je protein koji je kod ljudi kodiran genom LRG1.[5]

Aminokiselinska sekvenca

Simboli
1020304050
MSSWSRQRPKSPGGIQPHVSRTLFLLLLLAASAWGVTLSPKDCQVFRSDH
GSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLS
SNGLESLSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKEN
QLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQL
ETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLAR
VAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNP
WICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ

Funkcija

Pokazalo se da porodica leucinom bogatih proteina (LRR), uključujući LRG1, učestvuje u interakcijama protein-protein, transdukciji signala adheziji ćelija i razvoju. LRG1 se i+ekspzimirta tokom diferencijacije granulocita.[5][6]

LRG1 je također uključen u promociju neovaskularizacije (rasta novih krvnih sudova), uzrokujući prebacivanje u transformiranju signala faktora rasta beta (TGFbeta) u endotelnim ćelijama. LRG1 se veže na akcesorni receptor endoglina i promovira signalizaciju putem ALK1Smad1 / 5/8.[7]

Primjena

Razine LRG proteina su izrazito povišene u akutnoj upali slijepog crijeva i stoga se mogu koristiti kao dijagnostički pokazatelj.[8]

LRG1 može biti potencijalni terapijski cilj za liječenje bolesti kod kojih postoji aberantna neovaskularizacija.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000171236 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000037095 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: LRG1 leucine-rich alpha-2-glycoprotein 1".
  6. ^ O'Donnell LC, Druhan LJ, Avalos BR (septembar 2002). "Molecular characterization and expression analysis of leucine-rich alpha2-glycoprotein, a novel marker of granulocytic differentiation". J. Leukoc. Biol. 72 (3): 478–85. PMID 12223515.
  7. ^ a b Wang X, Abraham S, McKenzie JA, Jeffs N, Swire M, Tripathi VB, Luhmann UF, Lange CA, Zhai Z, Arthur HM, Bainbridge JW, Moss SE, Greenwood J (juli 2013). "LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling". Nature. 499 (7458): 306–11. doi:10.1038/nature12345. PMC 3836402. PMID 23868260.
  8. ^ Vargas IM (23. 6. 2009). "A urine test for appendicitis?". HarvardScience Press Release. Harvard College. Pristupljeno 25. 6. 2009.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya