Share to:

LRRC8D

LRRC8D
Identifikatori
AliasiLRRC8D
Vanjski ID-jeviOMIM: 612890 MGI: 1922368 HomoloGene: 10004 GeneCards: LRRC8D
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za LRRC8D
Genomska lokacija za LRRC8D
Bend1p22.2Početak89,821,014 bp[1]
Kraj89,936,611 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za LRRC8D
Genomska lokacija za LRRC8D
Bend5|5 E5Početak105,847,835 bp[2]
Kraj105,980,302 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
volume-sensitive anion channel activity
Ćelijska komponenta citoplazma
integral component of membrane
integral component of plasma membrane
endoplasmic reticulum membrane
membrana
Endoplazmatski retikulum
Ionski kanal
ćelijska membrana
Biološki proces anion transmembrane transport
ion transport
regulation of anion transport
GO:0072468 Transdukcija signala
transmembrane transport
GO:0015915 transport
cell volume homeostasis
inorganic anion transport
taurine transport
aspartate transmembrane transport
cellular response to osmotic stress
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001134479
NM_018103

NM_001122768
NM_178701

RefSeq (bjelančevina)

NP_001127951
NP_060573

NP_001116240
NP_848816

Lokacija (UCSC)Chr 1: 89.82 – 89.94 MbChr 5: 105.85 – 105.98 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Leucinom-bogati protein sa ponavljanjima proteina 8D jest protein koji je kod ljudi kodiran genom LRRC8D sa hromosoma 1.[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 858 aminokiselina, a molekulska težina 98.201 Da.[6]

1020304050
MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKD
QVVCLPVLPSPVNSKAHTPPGNAEVTTNIPKMEAATNQDQDGRTTNDISF
GTSAVTPDIPLRATYPRTDFALPNQEAKKEKKDPTGRKTNLDFQQYVFIN
QMCYHLALPWYSKYFPYLALIHTIILMVSSNFWFKYPKTCSKVEHFVSIL
GKCFESPWTTKALSETACEDSEENKQRITGAQTLPKHVSTSSDEGSPSAS
TPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVED
SDLIYKLYVVQTVIKTAKFIFILCYTANFVNAISFEHVCKPKVEHLIGYE
VFECTHNMAYMLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKV
REESSFSDIPDVKNDFAFLLHMVDQYDQLYSKRFGVFLSEVSENKLREIS
LNHEWTFEKLRQHISRNAQDKQELHLFMLSGVPDAVFDLTDLDVLKLELI
PEAKIPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLRCLHVKFTDVA
EIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLT
KVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERI
PHAIFSLSNLQELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIVTIPP
SITHVKNLESLYFSNNKLESLPVAVFSLQKLRCLDVSYNNISMIPIEIGL
LQNLQHLHITGNKVDILPKQLFKCIKLRTLNLGQNCITSLPEKVGQLSQL
TQLELKGNCLDRLPAQLGQCRMLKKSGLVVEDHLFDTLPLEVKEALNQDI
NIPFANGI

Funkcija

Istraživanja su otkrila da je ovaj protein, zajedno sa ostalim LRRC8 proteinima LRRC8A, LRRC8B, LRRC8C i LRRC8E, podjedinica heteromernog proteina zapreminski reguliranog anionskog kanala.[7] Ti kanali (VRAC) ključni su za regulaciju veličine ćelije transportom hloridnih iona i raznih organskih osmolita, poput taurina ili glutamata, kroz plazmamembranu,[8] i to nije jedina funkcija na koju su ovi ionski kanali povezani.

Dok je LRRC8D jedan od mnogih proteina koji mogu biti dio VRAC-a, on je zapravo jedna od najvažnijih podjedinica za sposobnost kanala da funkcionira; drugi važan protein je LRRC8A.[9][10] Međutim, iako se zna da je neophodan za specifičnu VRAC funkciju, druge studije su otkrile da to nije dovoljno za cijeli raspon uobičajenih aktivnosti VRAC-a.[11] Tu dolaze drugi proteini LRRC8, jer različit sastav ovih podjedinica utiče na opseg specifičnosti za VRAC-eve.[12][13]

Pored svoje uloge u VRAC, porodica proteina LRRC8 je takođe povezana sa agamaglobulinemijom-5.[14]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000171492 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000046079 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: LRRC8A leucine rich repeat containing 8 family, member A".
  6. ^ "UniProt, Q7L1W4" (jezik: eng.). Pristupljeno 30. 11. 2021.CS1 održavanje: nepoznati jezik (link)
  7. ^ Voss FK, Ullrich F, Münch J, Lazarow K, Lutter D, Mah N, Andrade-Navarro MA, von Kries JP, Stauber T, Jentsch TJ (maj 2014). "Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC" (PDF). Science. 344 (6184): 634–8. Bibcode:2014Sci...344..634V. doi:10.1126/science.1252826. PMID 24790029. S2CID 24709412.
  8. ^ Jentsch TJ (maj 2016). "VRACs and other ion channels and transporters in the regulation of cell volume and beyond". Nature Reviews Molecular Cell Biology. 17 (5): 293–307. doi:10.1038/nrm.2016.29. PMID 27033257. S2CID 40565653.
  9. ^ Hyzinski-García MC, Rudkouskaya A, Mongin AA (novembar 2014). "LRRC8A protein is indispensable for swelling-activated and ATP-induced release of excitatory amino acids in rat astrocytes". The Journal of Physiology. 592 (22): 4855–62. doi:10.1113/jphysiol.2014.278887. PMC 4259531. PMID 25172945.
  10. ^ Yamada T, Wondergem R, Morrison R, Yin VP, Strange K (oktobar 2016). "Leucine-rich repeat containing protein LRRC8A is essential for swelling-activated Cl- currents and embryonic development in zebrafish". Physiological Reports. 4 (19): e12940. doi:10.14814/phy2.12940. PMC 5064130. PMID 27688432.
  11. ^ Okada T, Islam MR, Tsiferova NA, Okada Y, Sabirov RZ (mart 2017). "Specific and essential but not sufficient roles of LRRC8A in the activity of volume-sensitive outwardly rectifying anion channel (VSOR)". Channels. 11 (2): 109–120. doi:10.1080/19336950.2016.1247133. PMC 5398601. PMID 27764579.
  12. ^ Lutter D, Ullrich F, Lueck JC, Kempa S, Jentsch TJ (mart 2017). "Selective transport of neurotransmitters and modulators by distinct volume-regulated LRRC8 anion channels". Journal of Cell Science. 130 (6): 1122–1133. doi:10.1242/jcs.196253. PMID 28193731.
  13. ^ Planells-Cases R, Lutter D, Guyader C, Gerhards NM, Ullrich F, Elger DA, Kucukosmanoglu A, Xu G, Voss FK, Reincke SM, Stauber T, Blomen VA, Vis DJ, Wessels LF, Brummelkamp TR, Borst P, Rottenberg S, Jentsch TJ (decembar 2015). "Subunit composition of VRAC channels determines substrate specificity and cellular resistance to Pt-based anti-cancer drugs". The EMBO Journal. 34 (24): 2993–3008. doi:10.15252/embj.201592409. PMC 4687416. PMID 26530471.
  14. ^ Sawada A, Takihara Y, Kim JY, Matsuda-Hashii Y, Tokimasa S, Fujisaki H, Kubota K, Endo H, Onodera T, Ohta H, Ozono K, Hara J (decembar 2003). "A congenital mutation of the novel gene LRRC8 causes agammaglobulinemia in humans". The Journal of Clinical Investigation. 112 (11): 1707–13. doi:10.1172/JCI18937. PMC 281644. PMID 14660746.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya