Share to:

SNAI2

SNAI2
Identifikatori
AliasiSNAI2
Vanjski ID-jeviOMIM: 602150 MGI: 1096393 HomoloGene: 31127 GeneCards: SNAI2
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za SNAI2
Genomska lokacija za SNAI2
Bend8q11.21Početak48,917,598 bp[1]
Kraj48,921,740 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za SNAI2
Genomska lokacija za SNAI2
Bend16 A1|16 10.07 cMPočetak14,523,716 bp[2]
Kraj14,527,249 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija sequence-specific DNA binding
vezivanje sa DNK
vezivanje iona metala
GO:0001948, GO:0016582 vezivanje za proteine
nucleic acid binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
RNA polymerase II transcription regulatory region sequence-specific DNA binding
chromatin binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
E-box binding
Ćelijska komponenta citoplazma
jedro
nukleoplazma
Biološki proces Notch signaling pathway
negative regulation of vitamin D receptor signaling pathway
GO:0009373 regulation of transcription, DNA-templated
neural crest cell development
negative regulation of keratinocyte proliferation
regulation of bicellular tight junction assembly
positive regulation of cell migration
negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
transcription, DNA-templated
cellular response to epidermal growth factor stimulus
negative regulation of vitamin D biosynthetic process
regulation of chemokine production
multicellular organism development
negative regulation of chondrocyte differentiation
negative regulation of DNA damage response, signal transduction by p53 class mediator
regulation of osteoblast differentiation
osteoblast differentiation
canonical Wnt signaling pathway
negative regulation of canonical Wnt signaling pathway
negative regulation of cell adhesion mediated by integrin
negative regulation of anoikis
GO:1901227 negative regulation of transcription by RNA polymerase II
epithelial to mesenchymal transition
epithelial to mesenchymal transition involved in endocardial cushion formation
cell migration involved in endocardial cushion formation
sluh
desmosome disassembly
pigmentation
epithelium development
negative regulation of extrinsic apoptotic signaling pathway in absence of ligand
aortic valve morphogenesis
negative regulation of cell adhesion involved in substrate-bound cell migration
response to radiation
Ćelijska migracija
positive regulation of histone acetylation
negative regulation of apoptotic process
positive regulation of fat cell differentiation
white fat cell differentiation
roof of mouth development
cartilage morphogenesis
regulation of branching involved in salivary gland morphogenesis
cellular response to ionizing radiation
negative regulation of stem cell proliferation
Notch signaling involved in heart development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003068

NM_011415

RefSeq (bjelančevina)

NP_003059

NP_035545

Lokacija (UCSC)Chr 8: 48.92 – 48.92 MbChr 16: 14.52 – 14.53 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Protein SNAI2 cinkovog prsta je transkripcijski faktor koji je kod ljudi kodiran genom SNAI2. Podstiče diferencijaciju i migraciju određenih ćelija i ima ulogu u pokretanju gastrulacije.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 268 aminokiselina, а molekulska težina 29.986 Da.[8]

1020304050
MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSS
GAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHS
GSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLH
CDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLL
QGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTF
SRMSLLHKHEESGCCVAH

Funkcija

Ovaj gen kodira člana nadporodice puževa tipa tranckripcijskog faktora cinkovih prstiju. Kodirani protein djeluje kao represortranskripcije koji se veže za motive E-kutija i također vjerojatno potiskuje E-kadherinsku transkripciju u karcinomu dojke. Ovaj protein je uključen u epitelno-mezenhimske tranzicije i ima antiapoptotsku aktivnost. Regulira diferencijaciju i migraciju čelija nervnog grebena, zajedno s produktima drugih gena (npr. FOXD3, SOX9 i SOX10, BMP) u embrionskom stadiju. Mutacije u ovom genu mogu biti povezane sa sporadičnim slučajevima defekata nervne cijevi.[7][9]

SNAI2 snižava ekspresiju E-kadherina u ćelijama prehladanog nervnog grebena; stoga, SNAI2 inducira čvrsto vezane epitelne ćelijee da se razbiju u labavi mezenhimski fenotip, dopuštajući gastrulaciju mezoderma u embriju u razvoju.[10][11] Strukturno je sličan antiapoptotskom Ces-1 u C. elegans. SLUG je negativni regulator produktivne ćelijske smrti embrijona u razvoju i odraslih.[10][12]

Klinički značaj

Široko eksprimiran u ljudskim tkivima, SLUG je najviše prisutan u leukocitima periferne krvi, jetri odraslih i u tkivima mozga fetusa i odraslih.[12] SLUG plays a role in breast carcinoma as well as leukemia by downregulation of E-cadherin, which supports mesenchymal phenotype by shifting expression from a Type I to Type II cadherin profile.[12][13] Održavanje mezenhimskog fenotipa omogućava metastaziranje tumorskih ćelija, iako se SLUG eksprimira u karcinomima bez obzira na invazivnost.[10][11][12] Model nokauta koji koristi kokošije embrione također je pokazao inhibiciju dezaminacije mezodermnog i nervnog grebena; izgleda da dobitak funkcije puža povećava proizvodnju nervnog grebena.[10] Mutacije u pužu, kod nekih životinja povezane su s gubitkom trudnoća tokom gastrulacije.[10]

Interakcije

BMP prethode ekspresiji SLUG -a i sumnja se da su neposredni uzvodni induktori ekspresije gena.[11][14]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000019549 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022676 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Rhim H, Savagner P, Thibaudeau G, Thiery JP, Pavan WJ (Jan 1998). "Localization of a neural crest transcription factor, Slug, to mouse chromosome 16 and human chromosome 8". Mammalian Genome. 8 (11): 872–3. doi:10.1007/s003359900601. PMID 9337409. S2CID 2177885.
  6. ^ Cohen ME, Yin M, Paznekas WA, Schertzer M, Wood S, Jabs EW (august 1998). "Human SLUG gene organization, expression, and chromosome map location on 8q". Genomics. 51 (3): 468–71. doi:10.1006/geno.1998.5367. PMID 9721220.
  7. ^ a b "Entrez Gene: SNAI2 snail homolog 2 (Drosophila)".
  8. ^ "UniProt, O43623" (jezik: engleski). Pristupljeno 21. 9. 2021.
  9. ^ Stegmann, K.; Boecker, J.; Kosan, C.; Ermert, A.; Kunz, J.; Koch, M. C. (august 1999). "Human transcription factor SLUG: mutation analysis in patients with neural tube defects and identification of a missense mutation (D119E) in the Slug subfamily-defining region". Mutation Research. 406 (2–4): 63–69. doi:10.1016/s1383-5726(99)00002-3. ISSN 0027-5107. PMID 10479723.
  10. ^ a b c d e Nieto MA (mart 2002). "The snail superfamily of zinc-finger transcription factors". Nature Reviews Molecular Cell Biology. 3 (3): 155–66. doi:10.1038/nrm757. PMID 11994736. S2CID 8330951.
  11. ^ a b c Carlson BM (2013). Human Embryology and Developmental Biology (5th izd.). Philadelphia, PA: Elsevier Health Sciences. str. 101–102, 106, 313, 362, 382. ISBN 978-1-4557-2794-0.
  12. ^ a b c d Inukai T, Inoue A, Kurosawa H, Goi K, Shinjyo T, Ozawa K, Mao M, Inaba T, Look AT (septembar 1999). "SLUG, a ces-1-related zinc finger transcription factor gene with antiapoptotic activity, is a downstream target of the E2A-HLF oncoprotein". Molecular Cell (jezik: engleski). 4 (3): 343–52. doi:10.1016/S1097-2765(00)80336-6. PMID 10518215.
  13. ^ Kalluri R, Weinberg RA (juni 2009). "The basics of epithelial-mesenchymal transition". The Journal of Clinical Investigation (jezik: engleski). 119 (6): 1420–8. doi:10.1172/jci39104. PMC 2689101. PMID 19487818.
  14. ^ Sakai D, Wakamatsu Y (2005). "Regulatory mechanisms for neural crest formation". Cells Tissues Organs. 179 (1–2): 24–35. doi:10.1159/000084506. PMID 15942190. S2CID 1886380.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya