Share to:

SPRYD7

SPRYD7
Identifikatori
AliasiSPRYD7
Vanjski ID-jeviOMIM: 607866 MGI: 1913924 HomoloGene: 10725 GeneCards: SPRYD7
Lokacija gena (čovjek)
Hromosom 13 (čovjek)
Hrom.Hromosom 13 (čovjek)[1]
Hromosom 13 (čovjek)
Genomska lokacija za SPRYD7
Genomska lokacija za SPRYD7
Bend13q14.2Početak49,912,702 bp[1]
Kraj49,936,490 bp[1]
Lokacija gena (miš)
Hromosom 14 (miš)
Hrom.Hromosom 14 (miš)[2]
Hromosom 14 (miš)
Genomska lokacija za SPRYD7
Genomska lokacija za SPRYD7
Bend14|14 D1Početak61,769,442 bp[2]
Kraj61,794,335 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001127482
NM_020456

NM_025697
NM_001310603

RefSeq (bjelančevina)

NP_001120954
NP_065189

NP_001297532
NP_079973

Lokacija (UCSC)Chr 13: 49.91 – 49.94 MbChr 14: 61.77 – 61.79 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

SPRY protein 7 sa domenom (SPRYD7), znan i kao protein 6 delecijske regije hronične limfocitne leukemije (CLLD6) je protein koji je kod ljudi kodiran genom SPRYD7.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 196 aminokiselina, a molekulska težina 21.666 Da.[8].

Simboli
1020304050
MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICG
TGGCLASAPLHQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSL
VMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHC
PASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQIF

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000123178 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000021930 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Mabuchi H, Fujii H, Calin G, Alder H, Negrini M, Rassenti L, Kipps TJ, Bullrich F, Croce CM (Apr 2001). "Cloning and characterization of CLLD6, CLLD7, and CLLD8, novel candidate genes for leukemogenesis at chromosome 13q14, a region commonly deleted in B-cell chronic lymphocytic leukemia". Cancer Res. 61 (7): 2870–7. PMID 11306461.
  6. ^ Tiazhelova TV, Ivanov DV, Makeeva NV, Kapanadze BI, Nikitin EA, Semov AB, Sangfeldt O, Grander D, Vorob'ev AI, Einhorn S, Iankovskii NK, Baranova AV (Dec 2001). "[Transcription map of the 13q14 region, frequently deleted in B-cell chronic lymphocytic leukemia patients]". Genetika. 37 (11): 1530–7. PMID 11771308.
  7. ^ "Entrez Gene: C13orf1 chromosome 13 open reading frame 1".
  8. ^ "UniProt, Q5W111". Pristupljeno 5. 8. 2021.

Dopunska literatura

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya