Share to:

STX7

STX7
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1GL2

Identifikatori
AliasiSTX7
Vanjski ID-jeviOMIM: 603217 MGI: 1858210 HomoloGene: 37823 GeneCards: STX7
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za STX7
Genomska lokacija za STX7
Bend6q23.2Početak132,445,867 bp[1]
Kraj132,513,198 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za STX7
Genomska lokacija za STX7
Bend10|10 A4Početak24,025,200 bp[2]
Kraj24,066,120 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija SNAP receptor activity
GO:0001948, GO:0016582 vezivanje za proteine
chloride channel inhibitor activity
syntaxin binding
SNARE binding
Ćelijska komponenta integral component of membrane
reciklirajući endosom
Vezikula
endozom
late endosome
early endosome membrane
membrana
tertiary granule
ćelijska membrana
endocytic vesicle
lysosomal membrane
SNARE complex
azurophil granule
early endosome
immunological synapse
perinuklearno područje citoplazme
Lizozom
Egzosom
Sinapsna vezikula
Endomembranski sistem
Biološki proces positive regulation of receptor localization to synapse
organelle localization
positive regulation of T cell mediated cytotoxicity
vesicle docking
organelle assembly
intracellular protein transport
Fuzija vezikula
vesicle-mediated transport
regulation of protein localization to plasma membrane
regulation of molecular function
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003569
NM_001326578
NM_001326579
NM_001326580

NM_016797
NM_001358563

RefSeq (bjelančevina)

NP_001313507
NP_001313508
NP_001313509
NP_003560

NP_058077
NP_001345492

Lokacija (UCSC)Chr 6: 132.45 – 132.51 MbChr 10: 24.03 – 24.07 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Sintaksin-7 jest protein koji je kod ljudi kodiran genom STX7 sa hromosoma 6.[5][6]

U melanocitnim ćelijama ekspresija gena STX7 može biti regulisana transkripcijskim faktorom povezanim sa mikroftalmijom.[7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 261 aminokiselina, a molekulska težina 29.816 Da.[6]

1020304050
MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQ
QLQQKQQYTNQLAKETDKYIKEFGSLPTTPSEQRQRKIQKDRLVAEFTTS
LTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQ
PQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQG
DVIDSIEANVENAEVHVQQANQQLSRAADYQRKSRKTLCIIILILVIGVA
IISLIIWGLNH

Interakcije

Pokazalo se da je STX7 u interakciji sa STX8,[8] VPS18,[9] vezikulski membranski vezani protein 8[8][10] i VPS11.[9]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000079950 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000019998 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wang H, Frelin L, Pevsner J (October 1997). "Human syntaxin 7: a Pep12p/Vps6p homologue implicated in vesicle trafficking to lysosomes". Gene. 199 (1–2): 39–48. doi:10.1016/S0378-1119(97)00343-0. PMID 9358037.
  6. ^ a b "Entrez Gene: STX7 syntaxin 7".
  7. ^ Hoek KS, Schlegel NC, Eichhoff OM, Widmer DS, Praetorius C, Einarsson SO, Valgeirsdottir S, Bergsteinsdottir K, Schepsky A, Dummer R, Steingrimsson E (December 2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell & Melanoma Research. 21 (6): 665–76. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971. S2CID 24698373.
  8. ^ a b Antonin W, Holroyd C, Fasshauer D, Pabst S, Von Mollard GF, Jahn R (December 2000). "A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function". The EMBO Journal. 19 (23): 6453–64. doi:10.1093/emboj/19.23.6453. PMC 305878. PMID 11101518.
  9. ^ a b Kim BY, Krämer H, Yamamoto A, Kominami E, Kohsaka S, Akazawa C (August 2001). "Molecular characterization of mammalian homologues of class C Vps proteins that interact with syntaxin-7". The Journal of Biological Chemistry. 276 (31): 29393–402. doi:10.1074/jbc.M101778200. PMID 11382755.
  10. ^ Wade N, Bryant NJ, Connolly LM, Simpson RJ, Luzio JP, Piper RC, James DE (June 2001). "Syntaxin 7 complexes with mouse Vps10p tail interactor 1b, syntaxin 6, vesicle-associated membrane protein (VAMP)8, and VAMP7 in b16 melanoma cells". The Journal of Biological Chemistry. 276 (23): 19820–7. doi:10.1074/jbc.M010838200. PMID 11278762.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya