Share to:

TAAR2

TAAR2
Identifikatori
AliasiTAAR2
Vanjski ID-jeviOMIM: 604849 MGI: 2685071 HomoloGene: 110760 GeneCards: TAAR2
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za TAAR2
Genomska lokacija za TAAR2
Bend6q23.2Početak132,617,022 bp[1]
Kraj132,624,275 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za TAAR2
Genomska lokacija za TAAR2
Bend10|10 A4Početak23,814,470 bp[2]
Kraj23,817,481 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija signal transducer activity
G protein-coupled receptor activity
trace-amine receptor activity
Ćelijska komponenta ćelijska membrana
membrana
integral component of membrane
Biološki proces GO:0072468 Transdukcija signala
G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001033080
NM_014626

NM_001007266

RefSeq (bjelančevina)

NP_001028252
NP_055441

NP_001007267

Lokacija (UCSC)Chr 6: 132.62 – 132.62 MbChr 10: 23.81 – 23.82 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Receptor 2 pridružen aminu u tragovima (TAAR2), ranije znan kao G-protein spregnuti receptor 58 (GPR58), jest protein koji je kod ljudi kodiran genom TAAR2.[5][6][7][8] TAAR2 je koekspresivan sa poteinom Gα[8], ali do februara 2017. njegovi signalnotransdukcijski mehanizmi nisu utvrđeni.[8]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 351 aminokiselina, а molekulska težina 40.134 Da.[9]

1020304050
MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFM
AGSIFITIFGNLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYS
MIRSVENCWYFGLTFCKIYYSFDLMLSITSIFHLCSVAIDRFYAICYPLL
YSTKITIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSS
CPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRENQ
NNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLFDAL
TWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKES
E

Funkcija

Ljudski TAAR2 (hTAAR2) eksprimiran je u malom mozgu, mirisnim osjetljivim neuronima u mirisnom epitelu i leukocitima (tj. bijelim krvnim zrncima), između ostalih tkiva.[10][11] hTAAR1 i hTAAR2 su potrebni za aktivaciju bijelih krvnih zrnaca pomoću amina u tragovima u granulocitima.[12] Fenetilamin, para-tiramin i 3-jodtironamin su potpuni agonisti hTAAR2 sa EC50 vrijednosti od 0,43 ± 0,05 nanomola,0,52 ±  0,05 nM, i 0,25 ± 0,04 nM.[10]

Kod miševa TAAR2 je eksprimiran u nekoliko regija mozga uključujući hipokampus, mali mozak, korteks, raphe nuclei i habenulu.[13]

TAAR2-ovi nokaut-miševa imaju značajno viši nivo dopamina u strijatumskom tkivu od divljih vrsta i niži nivo norepinefrina u hipokampusu. Također, TAAR nokaut-miševa ima niži nivo ekspresije MAO-B u srednjem mozgu i strijatumu.[13]

Jednonukleotidni polimorfizam nonsens mutacija gena TAAR2 povezan je s shizofrenijom.[8][10] TAAR2 je vjerovatni pseudogen u 10–15% Azijata, što je posljedica polimorfizma koji proizvodi prerani stop kodon na aminokiselini 168.[8]

Kao neselektivni ligand za TAAR2 identificiran je 3-jodo-tironamin (T1AM).[11]

Također pogledajte

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000146378 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000059763 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Lee DK, Lynch KR, Nguyen T, Im DS, Cheng R, Saldivia VR, et al. (februar 2000). "Cloning and characterization of additional members of the G protein-coupled receptor family". Biochimica et Biophysica Acta (BBA) - Gene Structure and Expression. 1490 (3): 311–23. doi:10.1016/s0167-4781(99)00241-9. PMID 10684976.
  6. ^ Lindemann L, Ebeling M, Kratochwil NA, Bunzow JR, Grandy DK, Hoener MC (mart 2005). "Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors". Genomics. 85 (3): 372–85. doi:10.1016/j.ygeno.2004.11.010. PMID 15718104.
  7. ^ "Entrez Gene: TAAR2 trace amine associated receptor 2".
  8. ^ a b c d e Davenport AP, Alexander S, Sharman JL, Pawson AJ, Benson HE, Monaghan AE, Liew WC, Mpamhanga C, Battey J, Benya RV, Jensen RT, Karnik S, Kostenis E, Spindel E, Storjohann L, Tirupula K, Bonner TI, Neubig R, Pin JP, Spedding M, Harmar A (25. 6. 2015). "TAAR2". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Pristupljeno 22. 2. 2017.
  9. ^ "UniProt, Q9P1P5" (jezik: engleski). Pristupljeno 11. 10. 2021.
  10. ^ a b c Khan MZ, Nawaz W (oktobar 2016). "The emerging roles of human trace amines and human trace amine-associated receptors (hTAARs) in central nervous system". Biomedicine & Pharmacotherapy. 83: 439–449. doi:10.1016/j.biopha.2016.07.002. PMID 27424325.
  11. ^ a b Cichero E, Tonelli M (maj 2017). "New insights into the structure of the trace amine-associated receptor 2: Homology modelling studies exploring the binding mode of 3-iodothyronamine". Chemical Biology & Drug Design. 89 (5): 790–796. doi:10.1111/cbdd.12903. PMID 27863038. S2CID 21073152.
  12. ^ Babusyte A, Kotthoff M, Fiedler J, Krautwurst D (mart 2013). "Biogenic amines activate blood leukocytes via trace amine-associated receptors TAAR1 and TAAR2". Journal of Leukocyte Biology. 93 (3): 387–94. doi:10.1189/jlb.0912433. PMID 23315425. S2CID 206996784.
  13. ^ a b Kuvarzin S, Efimova E, Mor M, Katolikova N, Smirnova D, Kozlova A, Gainetdinov R (17. 11. 2020). "Trace amine-associated receptor 2: brain expression and it's [[[sic]]] role in neurochemistry and behaviour". European Neuropsychopharmacology. 40: S41–S42. doi:10.1016/j.euroneuro.2020.09.059. Sukob URL-a i wikilinka (pomoć)

Vanjski linkovi

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.


Šablon:TAAR ligandi Šablon:G-protein spregnuti receptori Šablon:Transmembranski ereceptori

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya