Share to:

THAP2

THAP2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2D8R

Identifikatori
AliasiTHAP2
Vanjski ID-jeviOMIM: 612531 MGI: 1914066 HomoloGene: 12039 GeneCards: THAP2
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za THAP2
Genomska lokacija za THAP2
Bend12q21.1Početak71,664,301 bp[1]
Kraj71,680,644 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za THAP2
Genomska lokacija za THAP2
Bend10|10 D2Početak115,204,309 bp[2]
Kraj115,220,348 bp[2]
Ontologija gena
Molekularna funkcija vezivanje iona metala
vezivanje sa DNK
nucleic acid binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta Jedarce
Biološki proces GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_031435

NM_025780

RefSeq (bjelančevina)

NP_113623

NP_080056

Lokacija (UCSC)Chr 12: 71.66 – 71.68 MbChr 10: 115.2 – 115.22 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

THAP protein 2 sa domenom je protein koji je kod ljudi kodiran genom THAP2.[5][6]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 228 aminokiselina, a molekulska težina 26 260 Da.[7].

1020304050
MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWVRLVRRKNFVPGKHT
FLCSKHFEASCFDLTGQTRRLKMDAVPTIFDFCTHIKSMKLKSRNLLKKN
NSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRR
KMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPL
EDFKILEQDQQDKTLLSLNLKQTKSTFI

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000173451 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020137 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Roussigne M, Kossida S, Lavigne AC, Clouaire T, Ecochard V, Glories A, Amalric F, Girard JP (Feb 2003). "The THAP domain: a novel protein motif with similarity to the DNA-binding domain of P element transposase". Trends Biochem Sci. 28 (2): 66–9. doi:10.1016/S0968-0004(02)00013-0. PMID 12575992.
  6. ^ "Entrez Gene: THAP2 THAP domain containing, apoptosis associated protein 2".
  7. ^ "UniProt, Q9H0W7". Pristupljeno 14. 8. 2021.

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya