Share to:

TICAM2

TICAM2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2M1W

Identifikatori
AliasiTICAM2
Vanjski ID-jeviOMIM: 608321 MGI: 3040056 HomoloGene: 11014 GeneCards: TICAM2
Lokacija gena (čovjek)
Hromosom 5 (čovjek)
Hrom.Hromosom 5 (čovjek)[1]
Hromosom 5 (čovjek)
Genomska lokacija za TICAM2
Genomska lokacija za TICAM2
Bend5q22.3Početak115,578,496 bp[1]
Kraj115,602,479 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za TICAM2
Genomska lokacija za TICAM2
Bend18|18 CPočetak46,690,358 bp[2]
Kraj46,707,600 bp[2]
Ontologija gena
Molekularna funkcija signal transducer activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta citoplazma
endozom
late endosome
Golđijev aparat
early endosome membrane
membrana
late endosome membrane
ćelijska membrana
early endosome
Endoplazmatski retikulum
endosome membrane
secretory granule membrane
Biološki proces toll-like receptor 4 signaling pathway
negative regulation of chemokine (C-C motif) ligand 5 production
immune system process
TRAM-dependent toll-like receptor 4 signaling pathway
TRIF-dependent toll-like receptor signaling pathway
positive regulation of toll-like receptor 4 signaling pathway
positive regulation of I-kappaB kinase/NF-kappaB signaling
inflammatory response
cellular response to lipopolysaccharide
I-kappaB kinase/NF-kappaB signaling
negative regulation of toll-like receptor 4 signaling pathway
MyD88-independent toll-like receptor signaling pathway
GO:0072468 Transdukcija signala
GO:0060554, GO:0060555 necroptosis
apoptotic signaling pathway
negative regulation of MyD88-independent toll-like receptor signaling pathway
Urođeni imunski sistem
neutrophil degranulation
positive regulation of chemokine (C-C motif) ligand 5 production
positive regulation of interleukin-18-mediated signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_021649

NM_173394

RefSeq (bjelančevina)

NP_067681
NP_001157940
NP_001157941

NP_775570

Lokacija (UCSC)Chr 5: 115.58 – 115.6 MbChr 18: 46.69 – 46.71 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Adapterska molekula 2 sa domenom TIR je protein koji je kod ljudi kodiran genom TICAM2.[5]

TIRP je toll/interleukinski-1 receptor (IL1R; MIM 147810) (TIR) adapterski prptein sa domenom, uključenim u signalizaciju Toll-receptora (vidi: TLR4; MIM 603030; prema OMIM)[5]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 235 aminokiselina, a molekulska težina Da. 26 916[6]

1020304050
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSN
TTEGPTGKQEGAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLL
QDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLTENFLRDTWCN
FQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESR
GFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000243414 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000056130 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: TICAM2 toll-like receptor adaptor molecule 2".
  6. ^ "UniProt, Q86XR7" (jezik: англ.). Pristupljeno 15. 10. 2021.CS1 održavanje: nepoznati jezik (link)

Dopunska literatura

V anjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya