Share to:

FASTA

Tham khảo

FASTA là một giải thuật bắt cặp trình tự được David J. LipmanWilliam R. Pearson miêu tả lần đầu tiên vào năm 1985 (Rapid and sensitive protein similarity searches).

Ban đầu dùng để so sánh trình tự protein nhưng sau đó nó được cải biến để tìm kiếm cả trình tự DNA.Hiện nay, gói công cụ FASTA chứa tất cả các chương trình cho protein: protein; DNA: DNA; protein: translated DNA (tất cả các khung); DNA: protein và tìm kiếm các peptide.

Ngoài ra, FASTA package cũng cung cấp chương trình SEARCH, một phụ trợ của thuật toán Smith-Waterman algorithm.

Nhiều phần mềm tin sinh học cần dữ liệu trình tự DNA hoặc protein theo kiểu định dạng FASTA như ví dụ minh họa dưới đây.

>tên trình tự 
LCLYTHIGRNIYYGSYLYSETWNTGIMLLLITMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGTNLV
EWIWGGFSVDKATLNRFFAFHFILPFTMVALAGVHLTFLHETGSNNPLGLTSDSDKIPFHPYYTIKDFLG
LLILILLLLLLALLSPDMLGDPDNHMPADPLNTPLHIKPEWYFLFAYAILRSVPNKLGGVLALFLSIVIL
GLMPFLHTSKHRSMMLRPLSQALFWTLTMDLLTLTWIGSQPVEYPYTIIGQMASILYFSIILAFLPIAGX
IENY

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya