Share to:

SRPRB

SRPRB
Identifikatori
AliasiSRPRB
Vanjski ID-jeviOMIM: 616883 MGI: 102964 HomoloGene: 6332 GeneCards: SRPRB
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za SRPRB
Genomska lokacija za SRPRB
Bend3q22.1Početak133,784,023 bp[1]
Kraj133,825,772 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za SRPRB
Genomska lokacija za SRPRB
Bend9|9 F1Početak103,065,231 bp[2]
Kraj103,079,336 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
signal recognition particle binding
GTP binding
Ćelijska komponenta endoplasmic reticulum membrane
cytoplasmic microtubule
citoplazma
integral component of membrane
signal recognition particle receptor complex
intracellular anatomical structure
Endoplazmatski retikulum
membrana
Biološki proces IRE1-mediated unfolded protein response
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_021203
NM_001379313

NM_009275

RefSeq (bjelančevina)

NP_067026
NP_001366242

NP_033301

Lokacija (UCSC)Chr 3: 133.78 – 133.83 MbChr 9: 103.07 – 103.08 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Podjedinica signalnog prepoznavanja receptorske čestice jest protein koji je kod ljudi kodiran genom SRPRB sa hromosoma 3.[5][6][7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 271 aminokiselina, a molekulska težina 29.702 Da.[7]

1020304050
MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLT
LVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSC
AVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQR
EVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKE
LNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKG
GRGDVGSADIQDLEKWLAKIA

Funkcija

Protein kodiran ovim genom sličan je mišjem proteinu koji je podjedinica receptora čestica za prepoznavanje signala (SR). Ova podjedinica je transmembranska GTPaza koja pripada natpotodici GTPaza. Ona sidri alfa podjedinicu, GTPazu periferne membrane, za ER membranu (ER). SR je potreban za kotranslacijsko ciljanje i sekretornih i membranskih proteina na ER membranu.[7]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000144867 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000032553 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Miller JD, Tajima S, Lauffer L, Walter P (Mar 1995). "The beta subunit of the signal recognition particle receptor is a transmembrane GTPase that anchors the alpha subunit, a peripheral membrane GTPase, to the endoplasmic reticulum membrane". J Cell Biol. 128 (3): 273–82. doi:10.1083/jcb.128.3.273. PMC 2120348. PMID 7844142.
  6. ^ Legate KR, Falcone D, Andrews DW (Oct 2000). "Nucleotide-dependent binding of the GTPase domain of the signal recognition particle receptor beta-subunit to the alpha-subunit". J Biol Chem. 275 (35): 27439–46. doi:10.1074/jbc.M003215200. PMID 10859309.
  7. ^ a b c "Entrez Gene: SRPRB signal recognition particle receptor, B subunit".

Dopunska literatura

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya