Alike 2.0 Generic license. Attribution: Caffè Nero 70-71 High St, Exeter EX4 3DT by Roger A Smith You are free: to share – to copy, distribute and transmit...

Attribution-Share Alike 2.0 truetrue English Exwick Heights Primary School EX4 2FB object of statement has role: photographer author name string: Peter...

0 Creative Commons Attribution-Share Alike 4.0 truetrue English 2023 MG EX4 author name string: Calreyn88 Wikimedia username: Calreyn88 URL: https://commons...

0 Creative Commons Attribution-Share Alike 4.0 truetrue English 2023 MG EX4 author name string: Calreyn88 Wikimedia username: Calreyn88 URL: https://commons...

edu/posts/1151 URL: https://www.lroc.asu.edu/ckeditor_assets/pictures/902/content_bellE_ex4.png determination method or standard: JImagehash perceptual hash...

Creative Commons Attribution-Share Alike 4.0 truetrue English Corvus Terrain EX4 Pro EPS at Agritechnica 2023 object of statement has role: photographer object...

Description2023 MG EX4.jpg English: MG EX4 Date 14 July 2023, 11:29:39 Source Own work Author Calreyn88...

Description2023 MG EX4 2.jpg English: MG EX4 Date 14 July 2023, 11:29:04 Source Own work Author Calreyn88...

DescriptionEX4 Chipset.png English: ex4 Date 24 February 2010 Source Own work Author Cliffkinard...

Description2023 MG EX4 1.jpg English: MG EX4 Date 14 July 2023, 11:29:17 Source Own work Author Calreyn88...

DescriptionEx4.xcf English: example problem 4 circuit analysis wikibook starting point Date 2 January 2013, 09:47:45 Source Own work Author 1sfoerster...

DescriptionEx4-junctions.xcf English: example problem 4 circuit analysis wikibook step 4 junctions added Date 2 January 2013, 09:47:45 Source Own work...

.......... 1 2 3 4 5 6 7 8 9 10 11 cov pid 81 . 1 . ex2 ex3 . . . ex3 ex4 Hsa_FAM131A 100.0% 100.0% SSVDSQD--------------------------LPEVNVGDTVAML...

DescriptionEx4-MuPAD.xcf English: Mupad solution to example 4 circuit theory wikibook Date 2 January 2013, 11:43:15 Source Own work Author 1sfoerster...

DescriptionEx4-MatLab.xcf English: Matlab solution to circuit analysis example 4 11 equations and unknowns Date 2 January 2013, 12:26:39 Source Own work...

mittlere Höhe 11 und 12 100–1 000 200–500 Gemischt Sand und Kies R-EX4 groß, mittlere Höhe 10, 11 und 12 > 1 000 200–500 Gemischt Kies und...

2 3 4 5 6 7 8 9 10 11 12 13 1 2 3 4 5 6 7 8 9 10 11 12 13 1 TMEM1 Ex3|Ex4 TMEM2 60 Human MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILH...

Mellemstort, intermediær 11 og 12 100-1 000 200-500 Blandet Sand og grus R-EX4 Stort, intermediær 10, 11 og 12 > 1 000 200-500 Blandet Grus og rullesten...

DescriptionEx4-Loops.xcf English: example problem 4 circuit analysis step 3 loops added Date 2 January 2013, 09:47:45 Source Own work Author 1sfoerster...

Yin-Yang aaacccatggcaaccaaaacctcatgtcctggatatgcaaggaaaacagagtcgcgcttc 540 ex3|ex4 N P W Q P} K P H V L D M Q G K Q S] R A S 136 helix 4 helix 5 Yin-Yang ...

ctcatgctcctgcctcagcccccaagagctgggatcacaggtgtgagccactgtgcccag Ex3|Ex4 Region DUF5594 Ex4|Ex5 Ex5|Ex6 Region SMAP polyA signal sequence major polyA site...

622 Q I L K E E H Q K D L Q E V T A K T K T 125 ex3/ex4 gagatgtatcaaaacatggatgacgaaatgaagagagagcacttggctgcagaacagcgc 662 E M Y Q...

gc​ ​ tc ​ K I P E E C V A E E E L P H L​ ​ ​ L​ ​ T E R L​ 418​ ​ ex3|ex4​ 133​ ​ ​cagatgtgtacagtacatcgccctctctgggtcgttattttacttcagttgaaatagtg​ 4...

DescriptionQBW ex4 600.png Français : verbe LIRE (rouge) Date 13 December 2016 Source Own work Author Contactcc...

human genome transmembrane region 8 stem loop transmembrane region 1 ex3|ex4 ex4|ex5 transmembrane region 3 [leucine coiled coil] [F..Y motif] ex5|ex6...

1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 8 1 TMEM1 Ex3|Ex4 TMEM2 60 Human MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILLancelet...

gcagcca​gg​attgtgctc Q L L C P ​D​ F ​P​ L E L T Q ​K​ A A R I V L 420​ ex4 ex5 125 s​ umoylation atggacgatgccatggactgcttgatgtctttttcagatttcctctttgccttccagatc...

ja rahnud 11 ja 12 10–100 < 200 Segatüüpi pealiskord Liiv ja muda R-EX4 Suured keskmisel kõrgusel asuvad jõed R-EX5 Tasandikul: väikesed madali­...

consensus 102 103 104 105 121 109 108 108 107 121 ex3|ex4 162 163 164 165 181 169 168 168 167 181 ex4|ex5 ex5|ex6 PRLTEICVGILGNMACYKETCRSITSNENLVEVLI...

135 ctgtactcaaccatcttagggcatcagattggactttcaggcagggaagcccacgaggag 720 ex3|ex4 L Y S T I L G H Q I G L S G R E A H E E 155 ataaacatcaccttcaccctgcctacag...

magas fekvésű 11 és 12 100–1 000 200–500 Vegyes Homok és kavics R-EX4 Nagy, közepes fekvésű 10, 11 és 12 > 1 000 200–500 Vegyes Kavics és...

bound 86 ARM-like|pred NES 359 106 Symportin-1_like 419 ex3|ex4 bound 126 pred MAPK 479 ex4|ex5 bound 146 539 ex5|ex6 bound 166 *pred phos 599 186 659...

Y E S 600 ex3|ex4 95 ccctattggagaacctggatgaccattacccagagctggcagaggaactgcgcaggctgt L L E N L D D H Y P E L A E E L R R L S 660 ex4|ex5 115 Disordered...

kõrgusel asuvad jõed 11 ja 12 100–1 000 200–500 Segatüüpi Liiv ja kruus R-EX4 Suured keskmisel kõrgusel asuvad jõed 10, 11 ja 12 > 1 000 200–500 Segatüüpi...

közepes magasságú 11 and 12 100–1 000 200–500 vegyes homok és kavics R-EX4 Nagyméretű, közepes magasságú 10, 11 and 12 > 1 000 200–500 vegyes ...

* .**.. * .. ...... . . *..**..* Fungal Symportin-1 Like Motif ex3|ex4 ex4|ex5 Armadillo-type fold Lsa_SAAL1 Lan_SAAL1 Mes_SAAL1 Peq_SAAL1 Egu_SAAL1...

inter­ mediær 11 og 12 100 – 1 000 200 – 500 Blandet Sand og grus R-EX4 Stort, intermediær 10, 11 og 12 > 1 000 200 - 500 Blandet Grus og rulle­...

ctcatgctcctgcctcagcccccaagagctgggatcacaggtgtgagccactgtgcccag Ex3|Ex4 Region DUF5594 Ex4|Ex5 Ex5|Ex6 Region SMAP polyA signal sequence major polyA site...

720 ex3|ex4 V P P R P H S E P S R K I K E C F K T S ​240 Repeat 2A cont. agtgagaatcccttagtaattaaaaaggaagaaattaaggccaaaagaccaccatcacct 780 ex4|ex5 S E...

2] tcccggcgagccctaactatccaggagatcgctgcgctggccaggtcctccctgcatggt 358 ex3|ex4 S R R A L T I Q E I A A L A R S S L H G 109 atttcccaggtggtgaaggaccacgtga...

2 3 4 5 6 7 8 9 10 11 12 13 1 2 3 4 5 6 7 8 9 10 11 12 13 1 TMEM1 Ex3|Ex4 TMEM2 60 Human MSNNGADLTFGYISCFVAILLFGSNFVPLKKFDTGDGMFLQWVLCAAIWLVALVVNLILH...

mešana gramoz in prod 11 in 12 10–100 < 200 mešana pesek in mulj R-EX4 široka, srednjegorska R-EX5 nižina: majhna, nižinska SL 8.10.2013 ...

DescriptionEx4 elundi.jpg Русский: Фрагмент Эльюнди-русского словаря Source Own work Author Legella...

418 catcaaggtgccaacagggattattcaagatcaggttgtagccattttcaacaaggatca 478 ex3|ex4 ctgatcaaaattttctttttacaaagagatttacaagttaaacatgaagggaaaatactg 538...

120 ctagattcagaatataaggaaggtgggcaaaggaattgggttcaggtgttctgtaatgga 1019 ex3|ex4 L D S E Y K E G G Q R N W V Q V F C N G 140 gctgtacccacagaactggccctgctgt...

DescriptionEx4-symbols.png English: example problem 4 circuit analysis step 2 symbols added Date 2 January 2013, 09:47:45 Source Own work Author 1sfoerster...

magas fekvésű 11 és 12 100–1 000 200–500 Vegyes Homok és kavics R-EX4 Nagy, közepes fekvésű 10, 11 és 12 > 1 000 200–500 Vegyes Kavics és...

gaagaccagctagagaaccaaa T D H Y F L S D G L Y V P E D Q L E N Q 480 ex3|ex4 129 Ubq site 29 ex1|ex2 PDphos MAPK 240 a-hlx 49 Glyco B-sheet 69...

tmem2 cccgtcactgtacagccaccgcactgtgttcctgacacgtacagcaacgccacgctctgg 900 ex3|ex4 P V T V Q P P H C V P D T Y S N A T L W 215 tacaagatcttcacaactgccagagatg...

średnie, wyżynne 11 i 12 100–1 000 200 – 500 mieszane piaski i żwiry R-EX4 Duże, wyżynne 10, 11 i 12 > 1 000 200–500 mieszane żwiry i głazy R-EX5...

vidutinio dydžio, žemumų Lygumų: didelės, žemumų R-E1b R-E2 R-E3 R-E4 R-EX4 R-EX5 Lygumų: vidutinio dydžio, vidutiniame absoliutiniame aukštyje Didelės...

841 ex3/ex4 99 901 119 961 139 1021 159 1081 179 1141 199 1201 219 1261 239 1321 259 1381 279 1441 299 1501 319 1561 339 1621 359 1681 379 ex4/ex5 FWWh...

DescriptionA minor pentatonic for guitar ex4.png English: A minor pentatonic scale for guitar in tab and notation Date 26 July 2009 Source Own work Author...

augstumā 11. un 12. 100–1 000 200–500 Jaukta tipa Smilts un grants R-EX4 Lielas upes vidējā augstumā 10., 11. un 12. > 1 000 200–500 Jaukta tipa...

midaltitude 11 and 12 100 — 1 000 200 — 500 Mixed Sand and gravel R-EX4 Large, mid-altitude 10, 11 and 12 > 1 000 200 — 500 Mixed Gravel and...

Phosphorylation sites Blue = Leucine rich region [Transmembrane Domain Begin ex3|ex4 Transmembrane domain end] Bold = Highly conserved N-glycosylation site DUF4714...

DescriptionCPT-logic-gate ex4.svg logic gate question Date 1 July 2011, 10:52 (UTC) Source AND_gate.svg OR_gate.svg NOT_gate.svg Author AND_gate.svg:...

75.4% 85.5% 98.6% 71.6% 76.2% 71.6% 94.3% pid 81 . 1 . ex2 ex3 . . . ex3 ex4 SSVDSQD--------------------------LPEVNVGDTVAMLPK-------SRRALTIQEIAALARSSLHGISQVV...

nadmořská výška 11 a 12 100–1 000 200–500 smíšené písek a štěrk R-EX4 velké, střední nadmořská výška 10, 11 a 12 > 1 000 200–500 smíšené ...

medelstor, medel­ höjd 11 och 12 100–1 000 200–500 blandad sand och grus R-EX4 Stor, medelhöjd 10, 11 och 12 > 1 000 200–500 blandad grus och stenblock...

media altitudine 11 e 12 100 — 1 000 200 — 500 Miste Sabbia e ghiaia R-EX4 Di grandi dimensioni, media altitudine 10, 11 e 12 > 1 000 200 — 500...

11 agus 12 100 - 1 000 200 - 500 Measctha Gaineamh agus gairbhéal R-EX4 Mór, lár-airde 10, 11 agus 12 > 1 000 200 - 500 Measctha Gairbhéal...

Równiny: duże, nizinne piaski, iły i żwiry R-E4 Równiny: średnie, wyżynne R-EX4 Duże, wyżynne R-EX5 Równiny: małe, nizinne 11 i 12 > 1 000 < 200 podłoże...

jūros lygio 11 ir 12 100–1 000 200–500 Mišrios Smėlis ir žvyras R-EX4 Didelės, vidutiniame aukštyje virš jūros lygio 10, 11 ir 12 > 1 000 200–500...

visini 11 i 12 100 – 1 000 200 – 500 Mješovita Pijesak i šljunak R-EX4 Velike, na srednjoj nadmorskoj visini 10, 11 i 12 > 1 000 200 – 500 ...

mediano, altitud media 11 y 12 100-1 000 200-500 mixta arena y grava R-EX4 Grande, altitud media 10, 11 y 12 > 1 000 200-500 mixta grava y cantos...

augstumā 11. un 12. 100–1 000 200–500 Jaukta tipa Smiltis un grants R-EX4 Lielas upes vidējā augstumā 10., 11. un 12. > 1 000 200–500 Jaukta tipa...

DescriptionWD My Cloud EX4 face 20131119.jpg English: WD My Cloud EX4. Date 19 November 2013, 11:51:10 Source https://www.flickr.com/photos/vernieman/10945762296...

mittlere Höhe 11 und 12 100-1 000 200-500 Gemischt Sand und Kies R-EX4 groß, mittlere Höhe 10, 11 und 12 > 1 000 200-500 Gemischt Kies und...

vidējā augstumā 11. un 12. 100–1 000 200–500 jauktas smilts un grants R-EX4 Lielas upes vidējā augstumā 10., 11. un 12. > 1 000 200–500 jauktas...

100 < 200 mixta arena y limo Tipo Caracterización del río R-E1a R-EX4 Grande, altitud media R-EX5 Llanuras: pequeño, tierras bajas ES 8.10...

DescriptionOdakyu Tama Centre EX4-02.JPG English: Ex platform no.4 at Odakyu Tama Centre station 日本語: 小田急多摩センター駅の4番線跡 Date 7 January 2012 Source Own work...

Flachland: groß, Tiefland R-E4 Flachland: mittelgroß, mitt­ lere Höhe R-EX4 groß, mittlere Höhe R-EX5 Flachland: klein, Tiefland 11 und 12 > 1 000...

asuvad jõed 11 ja 12 100 – 1 000 200–500 Segatüüpi Liiv ja kruus R-EX4 Suured keskmisel kõrgusel asuvad jõed 10, 11 ja 12 > 1 000 200–500 Segatüüpi...

DescriptionZhongxiao Xinsheng Station Ex4.JPG 中文（臺灣）：​雨中的台北捷運忠孝新生站4號出口。 Date 16 January 2011, 14:55 Source Own work Author Howard61313...

Mellemstort, intermediær 11 og 12 100-1 000 200-500 Blandet Sand og grus R-EX4 Stort, intermediær 10, 11 og 12 > 1 000 200-500 Blandet Grus og rullesten...

altitude moyenne 11 et 12 100-1 000 200-500 Mixte Sable et gravier R-EX4 Grande, altitude moyenne 10, 11 et 12 > 1 000 200-500 Mixte Gravier...

nadmořská výška 11 a 12 100–1 000 200–500 smíšené písek a štěrk R-EX4 velké, střední nadmořská výška 10, 11 a 12 > 1 000 200–500 smíšené ...

midaltitude 11 and 12 100 – 1 000 200 – 500 mixed sand and gravel R-EX4 Large, mid-altitude 10, 11 and 12 > 1 000 200 – 500 mixed gravel and...

572 gaggaagtcttgaagtcagatattaccaaggatacaaaaacgacacattctaatctgctc 2340 ex3|ex4 E E V L K S D I T K D T K T T H S N L L 592 ccggattgctcaccttgtgaagagaggc...

DescriptionOkehampton Road postbox EX4 334.jpg Postbox EX4 334 outside Communication Workers Union branch office on Okehampton Road, Exeter, Devon, UK...

średnie, wyżynne 11 i 12 100–1 000 200 – 500 mieszane piaski i żwiry R-EX4 Duże, wyżynne 10, 11 i 12 > 1 000 200–500 mieszane żwiry i głazy R-EX5...

mid­ delhoog 11 en 12 100 – 1 000 200 – 500 Gemengd Zand en grind R-EX4 Groot, middelhoog 10, 11 en 12 > 1 000 200 - 500 Gemengd Grind en rotsblokken...

altitudine 11 e 12 100 – 1 000 200 – 500 mista sabbia e ghia­ ia R-EX4 Di grandi dimensioni, media altitudine 10, 11 e 12 > 1 000 200 - 500...

srednjegorska 11 in 12 100–1 000 200–500 mešana pesek in gramoz R-EX4 široka, srednjegorska 10, 11 in 12 > 1 000 200–500 mešana gramoz in...

DescriptionExeter university box EX4 340 (1473496454).jpg Exeter university box EX4 340 Date 1 October 2007, 13:56 Source Exeter university box EX4 340 Author bazzadarambler...

altitudine medie 11 și 12 100 – 1 000 200 – 500 total nisip și prundiș R-EX4 dimensiuni mari, altitudine medie 10, 11 și 12 > 1 000 200 - 500 total...

altitude moyenne 11 et 12 100- 1 000 200- 500 Mixte Sable et gravier R-EX4 Grande, altitude moyenne 10, 11 et 12 > 1 000 200- 500 Mixte Gravier...

altitude média 11 e 12 100 — 1 000 200 — 500 Mista Areia e cascalho R-EX4 Grande, altitude média 10, 11 e 12 > 1 000 200 — 500 Mista Cascalho...

medelstor, medelhöjd 11 och 12 100–1 000 200–500 Blandat Sand och grus R-EX4 Stor, medelhöjd 10, 11 och 12 > 1 000 200–500 Blandat Grus och stenblock...

altitudni medja 11 u 12 100 – 1 000 200 – 500 Taħlita Ramel u żrar R-EX4 Kbira, altitudni medja 10, 11 u 12 > 1 000 200 – 500 Taħlita Żrar u...

middelgroot, middelhoog 11 en 12 100-1 000 200-500 Gemengd Zand en grind R-EX4 Groot, middelhoog 10, 11 en 12 > 1 000 200-500 Gemengd Grind en rotsblokken...

imħallta żrar u blat lixx 11 u 12 10 - 100 < 200 imħallta ramel u ħama R-EX4 Kbira, altitudni medja R-EX5 Pjanuri: żgħira, art b’alti­ tudni baxxa...

altitudni medja 11 u 12 100–1 000 200–500 Imħallta Ramel u żrar R-EX4 Kbira, altitudni medja 10, 11 u 12 > 1 000 200–500 Imħallta Żrar u...

DescriptionCPT-logic-gate ex4 - Answers.svg Answers to logic gate question Date 1 July 2011, 10:52 (UTC) Source AND_gate.svg OR_gate.svg NOT_gate.svg...

seq. tgaaagctcaaattacacaagatgaatcttcttatcttctggaataacctatctttggat 660 ex3|ex4 E S S N Y T R] * 176 gtttcccaaagaagagtatgaagaatctaaagatgaaacattaaatgaatcataattatt...

DescriptionQuay box, Exeter EX4 70 (1473494712).jpg Quay box, Exeter EX4 70 Date 1 October 2007, 13:13 Source Quay box, Exeter EX4 70 Author bazzadarambler...

altitud media 11 y 12 100-1 000 200-500 años Mixto arena y grava R-EX4 Grande, altitud media 10, 11 y 12 > 1 000 200-500 años Mixto grava...

DescriptionOdakyu Tama Centre EX4-01.JPG English: Ex platform no.4 at Odakyu Tama Centre station 日本語: 小田急多摩センター駅の4番線跡 Date 7 January 2012 Source Own work...

mediumsized, midaltitude 100 — 1 000 200 — 500 Mixed Sand and gravel R-EX4 Large, mid- 10, 11 and altitude 12 > 1 000 200 — 500 Mixed Gravel and...

Exeter, Devon Abraham B R 1 Blackhall Road, Pennsylvania, Exeter, Devon EX4 4HD Abraham D E Oatens Farm, Churchstanton, Taunton, Somerset Acreman...

centre boxes ... EX4 345 (2532605806).jpg Exeter city centre boxes ... EX4 345 Date 27 May 2008, 10:08 Source Exeter city centre boxes ... EX4 345 Author bazzadarambler...

DescriptionPostbox ... Pinhoe Road Exeter EX4 107 (1447957029).jpg The centre of Exeter was heavily bombed and large cuboid boxes typically replaced what...

David's station EX4 10 (1473493696).jpg Exeter St. David's station EX4 10 Date 1 October 2007, 12:45 Source Exeter St. David's station EX4 10 Author bazzadarambler...

red verticals EX4 235 (879968460).jpg Exeter,just up from the iron bridge Date 30 October 2006, 15:56 Source Exeter ... red verticals EX4 235 Author bazzadarambler...

DescriptionExeter, Sidwell Street, Eastgate postbox EX4 345.jpg Collection plates of double-aperture postbox at the south-west end of Sidwell Street,...

boxes, Exeter EX4 13 13 (1443492357).jpg city centre boxes, Exeter EX4 13/13 Date 23 September 2007, 12:59 Source city centre boxes, Exeter EX4 13/13 Author...

DescriptionExeter, Wardrew Road, postbox EX4 246.jpg Postbox on Wardrew Road, Exeter, Devon, UK Date 2 August 2019 Source Own work Author George Nympton...

2) Order 2004 In the Schedule, the entry in relation to Emmanuel School, EX4 6SZ The Designation of Schools Having a Religious Character (Independent...

I. 2004/354 In the Schedule, the entry in relation to Emmanuel School, EX4 6SZ The Designation of Schools Having a Religious Character (Independent...

cacagcaaggtttttctgta 480 L G S W H G A E D E E A P S Q Q G F S V 78 ex3|ex4 ggagtgtcagaggttacagcttcaaagccctgtctgtccagccagaaggtccaccctagt 540 G V S E...

made 4 divers Experiments, to be fure of 4 the Fadt; but not one of thofe Ex4 periments * Remarks, Pag. 7. * perinients ever led me to any thing 8 that...

Exeter, Devon EX4 86 (1479432084).jpg Ten years ago. Date 3 October 2007, 14:10 Source Victorian box, Powderham Crescent, Exeter, Devon EX4 86 Author bazzadarambler...

Cowick Street, St. Thomas, Exeter - EX4 326 (1508085364) (2).jpg post office, Cowick Street, St. Thomas, Exeter - EX4 326 Date 7 October 2007, 14:40 Source...

* Exam. Form No. 10,000—Jan.. 1928 • • EX4/7 For rr\ *~10 1951$ ONTARIO department of Education ANNUAL DEPARTMENTAL EXAMINATIONS 1928 TIME TABLE...

School LA10 5RY Derbyshire Ockbrook School DE72 3RJ Devon Emmanuel School EX4 6SZ Orthodox Jewish Roman Catholic Orthodox Jewish Christian Methodist Church...

=a^bz-4?ga,r=4" s XR="3-+3t, drc. and afl^uming Sr, .f+B.,+Cn¢24-i)c3+Ex4, epr.,to exprefsthe feries fought, the feveral valuesof X, B, C, 1), Oc....

надморска височина 11 и 12 100 —1 000 200—500 смесено Пясък и чакъл R-EX4 Големи реки, на средна надморска височина 10, 11 и 12 > 1 000 200—500...

=a^bz-4?ga,r=4" s XR="3-+3t, drc. and afl^uming Sr, .f+B.,+Cn¢24-i)c3+Ex4, epr.,to exprefsthe feries fought, the feveral valuesof X, B, C, 1), Oc....

how men and work when are in earnest and love their work. it was not ex4 suppose really, we these that would be pected pictures to pieces, worth and...

of retaliation, 4 is unjust, and shall not be practised on either side, ex4 cent where there is a manifest violation of this treaty, < and then it shall...

Popular Culture 1 August 2004 The Old Library Prince of Wales Road Exeter EX4 4SB University of Glamorgan University of Glamorgan Artworks Collection...

oo 413,22 0406 90 21 on 243,10 0406 90 23 oo 189,81 0406 90 25 ex4) 189,81 0406 90 27 oo 189,81 0406 90 29 on 189,81 0406 90 31 oo...

England Derbyshire Ockbrook School DE72 3RJ Christian Devon Emmanuel School EX4 6SZ Christian Stover School TQ12 6QG Church of England West Buckland...

of Cinema and Popular Culture The Old Library Prince of Wales Road Exeter EX4 4SB University of Glamorgan Artworks Collection Oriel y Bont The University...

υψόμετρο 11 και 12 100 - 1 000 200 - 500 Μεικτή Άμμος και χαλίκια R-EX4 μεγάλου μεγέθους, ενδιάμεσο υψόμετρο 10, 11 και 12 > 1 000 200 - 500...

multiplier, doing well under all sorts of conditions. Will be grown more ex4> tensively than America, as soon as stock becomes sufficient. “A gem.” Grasp...

#declare attenk1=13; #declare kerr1=15; #declare ex4=pow(potens1,-nn*attenk1)*kerr1; #declare rr=ex4; #declare treshold1=0.5; #declare redi=treshold1;...

how men and work when are in earnest and love their work. it was not ex4 suppose really, we these that would be pected pictures to pieces, worth and...

E+64 + &C. &C.&C Now fuppofe AS'+ ESf+ CST+ DS + ES, + &c.=a +bx +cx +dX3+ex4+&c. and the correfpondentpartsrefpe6tively equalto.eachother; thatis, a (A+B+C+D+E+...

Plymouth PL6 7PE — 155 000 kg : Freezewest Ltd Chancel Lane Pinhoe Exeter EX4 8JS B 336 250 kg : 889/88 Movacold Ltd 159 Regent Road Liverpool L5 9TH...

Medicorum aut Philofophorum nemo nifi de nomine nouit. Quid enim refert eam aTE^Ex4«''> nuncupes? Verba tenes,rem vfu modo intelligis,cujus habet,qui fabricauit...

intheformerly mention'.d Experiments, publifhlt of theHear.by Attritionfin.the.ex4_ AboutProdwution 45., h3lufledReceiver. thle,fhaki;nof Qjck4.L'iniin 46;...

faint cc>lotlrX ycllowi0aflcripestht->lengtll of the Morm;tEleyh.ld ) atld EX4 fecta after the manacrc)f rnanyCatertillars fc>ne I urasalmo{t confident...

---- ---- ----- PROP MOORING WALL / ~ - '/ n..; ',.-I PR FISHI EX4' RIVERSIOE ENERGY GAS PLATFORM j I I AQUENTS, SANDY AND LOAMY EXGROUND)_...

revera ita accidere, qua quantitas dum 3t, ped. cub. effundi dicantur) cub. ex4 pedibus vafis B, plufquam capacitatem cedit. hoc facile caveri potuiXet,...

, He2 ), Generally safe C3 (Ex3 , En3 , He3 ), Relatively dangerous C4 (Ex4 , En4 , He4 ) and Dangerous C5 (Ex5 , En5 , He5 ). For the assessment indicators...

DescriptionImgEx4.jpg English: HTTP Get Example Date 27 September 2015 Source Own work Author Msfclipper...

ZIP-BILLING BILLZIP ZIP-BUSINESS BIZZIP SPEC1 BOARD1 SPEC2 B0ARD2 upin\super\EX4.XLS\pwt 2 EXHIBIT 4 (continued) VARIABLE NAMES FOR REGISTRY DATA ELEMENTS...

Kennford, Exeter R. V. Netherway, Farm Barton, Whitestone, Exeter, Devon EX4 2LF R. C. Coysh, East Coombe Farm, Mortonhampstead, Newton Abbot TQ13 8PT...

deplorable State during their Lives j whereas it has been found, by the Ex4 perience of many Years, that above two Thirds of the mad People received...

00 90 331,29 0406 10 10 0 238,69 0406 10 90 o 286,53 0406 20 10 ex4) 413,22 0406 20 90 n 413,22 0406 30 10 an 191,15 0406 30 31 Of)...

was in these terms : ‘ Finds, that the titles produced by the pursuers, as ex4 plained and confirmed by the acts of possession condescended on by them,...

o-uewr &le- C 4 02 o36o C €-e 4 48SeceuGal25,” . La Y2e. c C "d" 1+Ex4* e Wees , uee &Se 4 wr O < BacRun . Jo AoLes oa* c Rs ele alletu a...

unityz Upon thefe ftlppofitions the valteo£ti xnfinite iries a-bs+c:c.v-ds.3--e.x4-fi5+ga:6-k.t7+8cs. (in whichthe fecond, fourth, fixth, and eEhtfh, and every...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QG, UK 2 Centre for Networks and Collective Behaviour and Department of...

Risks: From the CSRA, the key or greater Schedule Risk items include:  EX4 – Federal Funding - GI Study was 100% Federal Supplemental Funded. Based...

job-step: EX2 job-step: COBOL job: GHI account no.: 1234 job-step: EX3 job-step: EX4 Figure 1. Analyzing accounting log data An initial inventory of applications...

shall be reimbursed 3 from applicable appropriations in this Act for travel ex4 penses incident to the holding of hearings as required by 5 5 U.S.C. 551–558:...

90-6 EO^ EX. EO3 EX, E2O3 MgX^ 79-Ot 79-95 94 4 Ca, i Al, &c. EX,, EX4 EX5 M = K, NaX (Pettersson) Zr (OM) = Z, where I (Burton) . KT)...

manifestly composed of very delicate tubules, which are attached by one ex4 Am,^ Mag, N. Hist* Ser. 3. VoUvf. 50 Prof. Allman on the Hydroid Zoophytes...

fuch * mafters in the art, that they diffipate every fhadow of fufpicion ex4 cited refpeCting their integrity. Perfons of the profoundeft {kill, of ...

that he could judge for himself of still 3 Bishop Drokensford sometimes ex4 literature before instituting him, but it does not appear that examinations...

ai säi avind o tuatie socialä care exclude putinta unei deei decretul de ex4-5 a fost revocat acum Orient, a fost priani, mit la era legenda Cit de Gaster...

teniendo igual suerte^i la volvió á restaurar D» Juan Ortiz diC ISarate. Esta ex4 posición es intolerable ^ pues aunque no hubieran, llegado; á manos del enunciado...

not mourn for the unhappy Contentions of them, to whom Chrift by his own ex4 ample folicitoufly commended the ftri&eft Bond of Cha1 rity No mind can be...

Park, Goodison Road, L4 4EL Everton Football Club St James Park, Exeter, EX4 6PX Exeter City Football Club Highbury Stadium, Park Avenue, Fleetwood...

shall be reimbursed 3 from applicable appropriations in this Act for travel ex4 penses incident to the holding of hearings as required by 5 5 U.S.C. 551–558:...

imaginary quantities, for it is expressed in finite terms by the formula ex4- + e-rx41 -. 2 Now I apprehend that we should not virtually escape from...

DescriptionVirtualBoxEx4.png Русский: Installation OS on Vbox Date 5 March 2021 Source Own work Author NazarChernikov...

DescriptionSmithEx4.png Smith chart Date 6 October 2006 Source Own work Author ChrisAngove...

VTIUTY ENGINEERll'IG JOB NO. 14001702LC SHEET NO. ~ 0 ' IX) 0 w EX4 § (l_ w z ::J 0 z :5 1w ~ w 0 0 ~ 0:: (.) ~ SOUTH RIGHT OF WAY...

it further enacted, That all officers of the emand they are hereby ex4 empted from performing ordinary military duijy work5 ing on public roads...

Kttmi m I n^**li^*fc m aifc r-' - --- •- - -- - - ds. ^ ^ 丄」 .4} 61 車 劉 EX4^^I 是自從 李膚？ lv0tM0,f hs-. r. 年光 4—9^,莉.都無覯，^ ,4. 無翁還 .^.*llr^『i.iss,^s...

Park, Goodison Road, L4 Everton Football Club 4EL St James Park, Exeter, EX4 6PX Exeter City Football Club Highbury Stadium, Park Avenue, Fleetwood...

phosphine concentrations of 100 200, 300, , each stage of the cigarette beetle ex4-00, or 500 p.p.m. at 80° F. Estimated exposures Upper Insect stage Adult...

Female Institute of 2. 3. Talladega,” for the use of his fine Chapel for our Ex4. amination Exercises and Concert. 5. 6. Thanks are also cordially rendered...

Boumediennt Ben Bella lo utilizó como emisario para, tareas difíciles en el ex4.900 Ptas I Queda Mohamed Boudiaf, largo tiempo perseguido por Ben Bella,...

Rootsof the Aquation d¢"-BXnt + C,"-2,,_gi)4%4?s3+ExF-4- Fxt-5+ eF. +fxS+ex4+ jX34 S_ o berealX andbythisLelnma a11theRootsof t11e Equation nw"-t-n_xBac"-2...

appellatur, &c; fic & 4 dicitur radix Qiiadrata ex 44 feu 4*-, & radix Cubica ex4^, & radix Quadrato-Quadrataex4^, & radix Surfolidaex4^, & radix Quadrato-Cubicaex4^...

deadened andj the fing |er was dressed,. the young men in the school are ex4| the sufferer gave his hat Id to the winner, pected to work on the farm connected...

juft to your Excellency, to own, that 4 we are abfolutely of Opinion, your Ex4 cellency has committed nothing to give 4 the leaft Pretenfions for any fort...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QG, UK JS, 0000-0002-2829-1503; GAN, 0000-0002-2322-108X Whether moral...

Surgical Diseases of the Ovaries and Fallopian Tubes,” Mr. Bland Sutton ex4 6 presses himself guardedly, saying the fetus dies. When this month...

Norwich NR4 7TJ, UK 6 Biosciences, University of Exeter, Stocker Road, Exeter EX4 4PY, UK CvO, 0000-0002-5653-738X; JL, 0000-0002-4228-1037 The guppy (Poecilia...

tene'ma, 5 fflu'idum, fpurifica'tum, Fer'ri a9eta'tis Euon'ymi fex ex4 gtt. gr, 2 .5 tr. % ta9eta'tis sethe'reus, ta9e'ti9itr. fextrac'tum...

musical. For all grades Castle's Entertainments. Recitations, dialogues, ex4 numbers for all grades, ercises, tableaux, etc. each 200 pages. Price each...

ur+op exception: evenings: ev exchange: ex+ch event: ev+ent excite: ex4-it ex+ep+tion ever: ev+er exercise: ex+cr n BOYD SHORTHAND DICTIONARY...

[ER9]: CàT, SeràPhe Comment [ER10]: CàT, Glnà nothing Comment [ER11]: Ex4/5 149 Comment [ER12]: Frame shift, goes to Gln (Q) 169 Comment [ER13]:...

watermelon tDrose'ra3, fextrac'tum 34.2 % [seeds]. 3 34.2 fl.:j; ex4 gr. fEpilo'bium angust. 5 34-1 great willow herb. fextrac'tum fl.J fEpiphe'gus...

LU&!i(»3'frcaciaai mosAnm --¥«>•> luskm.' jraWT'^" — Si qoaeriat de ex4|^ bofnimini nttmero tt»u$ est. qno mod» factnm sit, ut versqs itte in mulds...

perfonen daags. Men begon in te zien dat de befmetting het afzeilen der ex4°. De raadpleging ten öpzigte der vestingen van het Duitsch-verbond,tétt einde...

feguirs muy en bre: ve perfonalmente. Mas como las tafias , é impoGciones ex4 traordinarias no podian producir grandes cantidades , ha; viendoíé retirado...

venturedto give notice to my ailIlant at the clocld,4tto prepare,fincleI ex4' peded ilw;afew minutesto comeat a Rratumof thenebulz, " fitlding-myfelfalready"(as...

DescriptionEX4.06 Scodella con decorazione a scacchiera - Bowl with tesselation, 1510-20 -FG.jpg Italiano: Scodella con decorazione a scacchiera, 1510-20...

he should dare to touch the fiddler. 4 You rogue ! you beg'gar!’ at last ex4 claimed Hildebrand. Who told you to give that old fool of a fiddler that...

an acquittal, ' same crime for the i.r oftVnce. not be required, nor ex4. cessive lines imposed, noi cruel punishments inflicted ; Exces-iv<' biil...

чакъл и едри камъни 11 и 12 10 - 100 < 200 смесена пясък и тиня R-EX4 Големи реки, на средна надморска височина R-EX5 В равнините: Малки реки...

, , germ. ily seat is Charleville Forest. Fullamore, Hewett; Master of 'Ex4 ; The World does not attzibute Finance, J. 10. r The Boston Journal of Commerce...

already abandoned. All Europe is acquainted with the benevolent, the godlike ex4 I have known iostances of the hospital ertions of Howard, whose memory Sir...

tendency thereto, previous to the purging phyfic, when furely it was moft to be ex4. pelled ; there would it have been pru- dent, to pervert this ialutary...

tracting the oil made by crushing by pressure or solvents ; the seeds and ex4, used in the proportion of from 10 to 20 per used in the proportion of from...

ample MOIe/ of Vancouver .to nandlp tbo worV.and Mr. Miller has don» »« ex4*Hent job if it. H£ has .poshed ,.t* the mirk along at LU> the ?ipce ht'cjim*...

genere prtedantiflimus, qui (umrnas ingenii dotes, liberalibus difciplinis ex4 coluerat [ 17 ] coluerat, qui non lolum Medicinam, fed omnes Apollineas...

DescriptionEX4.07 Scodella con decorazione a scacchiera - Bowl with tesselation, 1510-20 -FG.jpg Italiano: Scodella con decorazione a scacchiera, 1510-20...

both flumes. Submergence begins to become a significant factor as h /h x ex4 ceeds 75 percent. The ordinate of figure 5 is discharge, Q, to observed...

nitrous acid. Up- on examining the water chemically, after each ofthefe ex4>eriv:ents, it did not afford a Jingle mark offulphur. I j* 15 h a v...

as Hand moft in need i ■ ' * of the affiftance of thefe falutiferous ex4 ' , I * • » ' halations, Aould be moft fufceptible of their energetic...

11 και 12 100 – 1 000 200 – 500 αναμεμειγμέ­ να άμμος και χαλίκια R-EX4 μεγάλου μεγέθους, ενδιάμεσο υψόμετρο 10, 11 και 12 > 1 000 200 - 500...

Research in Animal Behaviour, Psychology, University of Exeter, Exeter EX4 4QG, UK 2 School of Biosciences, Cardiff University, Museum Avenue, Cardiff...

Jeaj>»y/lt7n, ! <rrtKj X/ da.Jj\> cy^ /¡u^o-j /jfic/})yio^ ; , ly Ca/iJa-^ d~ex4«/p >0i rad (j^im« j ^ a^* <d/Mo/v-Cl/ ’ ddcYYK^w^a-^ ^/u/d*ddio Ja/{hu...

most effective people avail- Or leaders were narily young people mainly ex4-H Club members ? If so, has 4-H held the group-dependent and the shy young...

and farm laborers. _3/ Including private household and service workers. Ex4_/ cluding Alaska. Source: 1978 ESCS Landownership Survey. 9 Table 5...

DescriptionEX4.08c Grande piatto con decorazione a scacchiera - Large plate with tesselation, 1510-20 -FG.jpg Italiano: Grande piatto con decorazione...

DescriptionEX4.08a Grande piatto con decorazione a scacchiera - Large plate with tesselation, 1510-20 -FG.jpg Italiano: Grande piatto con decorazione...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QG, UK. Electronic supplementary material is available online at https://dx...

nonConceJfo} that I have forgot it, the * raoft you can make on’t, is, that fuch ex4 traoroinary Wits as mine, are generally 4 attended with the Want of Memory...

transcendental Ego may be spoken of, with strict propriety, as " the correlate of all ex4 Expressions such as these, coupled with the sharp distinction drawn between...

Hatherly Laboratories, University of Exeter, Prince of Wales Road, Exeter EX4 4PS, UK 6 Australian Institute of Marine Science, Perth, Western Australia...

forfan,qvod hic, juxta Ariftotelhdogma, illi*tantum animalibus injit, qv&ex4“* • <■' eremen- crementa ventris & 'tusjicahabeant^ illa verQ, qvibus...

. but thofe caufesfrorn the 'Suoor Earth'sOrb, w-hence_zbat proceeds,theEx4-entricitvy`of and.theObliquitIy of theZodiackJThe'former-ofthefe,if tingly...

DescriptionEX4.08b Grande piatto con decorazione a scacchiera - Large plate with tesselation, 1510-20 -FG.jpg Italiano: Grande piatto con decorazione...

"Chicka-aw navou Campaign." by Gen Stephen D Lee. 3. Shei man's .Meridian Ex4. pedition from Vicksburg to Meridian, l-ebruary 3rd to .March 6lh, 186?,...

3EJ Cambridge, UK Biosciences, University of Exeter, Stocker Road, Exeter EX4 4QD, UK 3 Institute of Biodiversity, Animal Health and Comparative Medicine...

3. The combat of David and Goliath, (1 Sam. xvii.) of the Narrative. IV. Ex4. The circumstances attending the Crucifixion of Jesus Christ. if the Sacrifice...

stethometer than by the unaided eye. Percussion. This important method of ex4. — amination is best practiced simply with the fingers; a great variety...

Transferred from zh.wikipedia to Commons by Pbdragonwang using CommonsHelper. The original description page was here. All following user names refer to...

inftitution, and that has 4 not acquired, fooner or later, immoderate wealth and ex4 orbitant power. 4 Few men are fo little acquainted with the hiftory of the...

for the meetings. That the churches where the meetings are held pay the ex4. penses of the preachers conducting them. 5. That the churches where the...

fpirit of almoft univerfal dif4 fatisfadion, and want of confidence in the ex4 ercife of government, muff produce, if not 4 prevented by feafonable remedies...

stethometer than, by the unaided eye. Percussion. This important method of ex4. viations amination is best practiced simply with the fingers; a great...

knowledge at all. knowledge. Neither sensations nor thought alone can give us ex4 perience, for if we attempt to set off the operations of the mind to conditions...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4PS, UK 2 Department of Environment, Earth and Ecosystems, The Open University...

wringers, family scales, meal-cul December, And at tl I- I P. B. i J and ex4 Dated Bridgeport, Oct. ■ ' ' • - j di ” isfor CASH, rc w This House...

Insights Team, London SW1H 9NP, UK 3 University of Exeter, Stocker Road, Exeter EX4 4PY, UK 2 KA, 0000-0003-0011-457X As genetic research into outcomes beyond...

a part of the difeafe, is 4 an effort of the vis medicatrix naturae, to ex4 pell this morbific mattter, and particularly to 4 change or concoct it, fo...

man, and even in some philosophers, to pass lightly over the diversities ex4. hibited of well to cast a brief preliminary glance at the content of...

housing ordinances? How many inspectors are there for each department; for ex4. ample, plumbing, new buildings, etc.? Do they inspect on their own initiative...

summer. Working States, 4-H community is re- two- Delwyn A. Dyer, Ex4-H youth, and Gene McMurtry, director of community refold, explained tension...

corroborated the reports given by the natives of the raid, but added in ex4)efor» Modisa-o-Tsile, that tenuation commencing the attack, delivered to...

upon the Subject. The papers, when delivered to the Member of the Board of Ex4. aminer appointed by the Council to examine upon the Subject, are to be l)y...

(LrdzacaX Sto7M¢ha vel trfdui & magnadofi adhibita: Bibus (fi bidlXX vcniantEx4?atiominimedoleantArticuli)in fubfidiu£n appli. trZtdmododida-Artiatiw creirrime...

organs which form each circle may vary from the smallest to the fullest ex4. tent, The degree and and through several remarkable differences of...

same direction. There is a curiously regular progression of distance (ex4. pressed by Bode's law, which, however, breaks down at Neptune) There is...

Service. and • Hot lunches for rural school children, meal planning and management, health money saving in food ex4—H food clubs penses, food pre...

important as many diseases of a mental origin stimulate those depending on ex4. ternal causes, and yet are only to be cured by ministering to the mind...

brook, tributary to the Goorgaun, called K,ara-soo, or black-water; and they ex4 D 2 tend up the right coast of the Caspian to above Balkan Bay, when,...

still has its devotees and pilgrims. The inn at Ancona, the " Pace," is ex4 cellent, and finding ourselves in such good quarters, we remained a month...

Subjects, Amateurs. 1877 hibition, Awarded Howard. ist Howell and James' Ex4>6 - Plaque, "Cowslip Balls," painted Messrs. Messrs. Howell and James...

nature. The Almighty ruler of a universe, in some sort independent of him, or ex4. The starting-point is is ternal to him, but the first cause of all...

and not have his bees run him." It is equally adapted to the producer of ex4. tracted honey. While it is true that in raising extracted honey, swarming...

Extension Service Review for April 1953 69 a chance for club members to ex4-H’ers at camp hospitality. is tend make their own bread and have occasion...

and disintegrated portions. As far as possible, surface water should be ex4. Third. cluded from the foundation-bed, and all possibility of running water...

boundary of the orbit of the eye ; this ridge is terminated outwardly by the ex4 ternal angular process, just within which is a depression for the lach-...

cordato-2-lobis multicymis serrulatis, oblongis stipulis rubris, nervis marginibusque ex4-5, fl. ? in in fl. foliolis 1, <$ rubro-aurantiaci floris, perianthii , ...

fibres Internal rootMagnified hair: sheath, consisting of two layers. I. Ex4. ternal root-sheath, c. Hair-follicle slightd. Where blood-vessel ly torn...

premium element. no of the which is foundry/' Shops experience reproduced in ex4 For this classification the national indications were hibit IV. modification...

their ions. Sufficiently diluted solutions of potassium chloride, for ex4- ample, contain the ions ; i. e., potassium as cation International...

were then attempted ought to be agitated. Mere agitation is a miserable ex4. But the chief point is this. cuse for breaking up so glorious a government...

)46::orAlqrs inadequate of 'AU,elf . =- to:.:_,any'hostile,4novernent-:against,the:Ex4,z '',.§,u10:un 30 Sultaun ; and believing that he could not prudently rely...

ammonium, and having the constitution has been assumed as the only method of ex4 plaining the perfect analogy that exists between the salts of ammonium and...

respect. ...... God depend on our views tent of his dominions, of the ex4-32 III. Science enlarges our views of the operations of Provi- dence in...

projects that could contribute to cost and schedule variance due to unknowns. EX4 Lake Okeechobee Regulation Schedule (LORS) EX5 Priority Change Priority...

pressed the subject of psalmody, the sentiments of the Church are thus ex4 : Singing God's praise is a part of public social worship, in which ...

Federation of July 1790. The Royal Family cheered by the Federates. — Chabroud's Ex4, St. 14, is amination and Report on the Events of October 72 CHAPTER...

is the natural man. Rousseau wants to form a natural man, a savage, as he ex4. What his conception of a he has shown in his essay on " The plains in...

tions, &c, situation, and other local and general progressive maturity— ex4. In the period of approaching and vigour of the tending to the twenty-fifth...

Plant, Golden, Colondo eg&g\geachcm.rpt\cxecsum.rpt SeptemberPage 30,1993 EX4 0 hydrocarbons from burning of organic material) and may indeed be present...

has a right 4 to complain ? A discretion to fix the doom of every convict, ex4 pressly given to the judges, would in all cases be most anxiously 4 and scrupulously...

been expended ; which Committee shall be called the Committee on Taxes and Ex4. penditures. Vi. The committees such appointments may, the vacancy filled...

sensations and tactual perceptions ; which can mean only that we have them or ex4 4 26 ON PERCEIVING OBJECTS" perience them at the same time, or in close...

Occurrendes at Push t—Extracts Mohammed ban arms—Is defe e R. Sale—The, ex4.1iiii? himself to Sir W. ;" • • ,., CONTENTS. vii CHAPTER XVIII. P...

Directors to be particularly atten$ive to their choice of Counsellors , on the ex4 , piration of the period, during which their patronage had been suspended...

attention was arrested by something else just then and I had no chance to ex4 4 ’ 4 4 plain. “Who that very important gentleman with the the one-eyed...

qu’on obtient de toutes parts , quelques exceptions, en supposant que ces ex4 ceptions ne résultassent pas de l’impéritie ou de l’inclairvoyance ? Nous...

the gallon. p ** sent session of Parliament, that they wof exchange such Ex4. With regard to starch, the duty will remain as proposed in “ “ ** ‘* chequer...

Imaus. The fea of Aral being furrounded with fandy defarts, has been little ex4 the antiquity Tooke's View of the Ruffian empire, i. ; 239. plored...

are reversed. Thus the long diameter is from before backwards, in a line ex4 ; POSITION OF THE PELVIS. 20 tending from the point of the coxyx to the...

elevating every rib as much as can be done. Hold the breath a moment and then ex4. inspiration full hale slowly. upper part upper ribs only to the fullest...

Murder. Melancholy Ccnfequcnces of this Affair„ French Directory make it an Ex4 CONTE NTS. ctife for overturning the Government, March of General Berthier...

been expended which Committee shall be called the Committee on Taxes and Ex4. penditures. VI. The committees such appointments may, the vacancy filled...

in Animal Behaviour, School of Psychology, University of Exeter, Exeter EX4 4QG, UK 2 MJMH, 0000-0003-0515-2348; NHdI, 0000-0002-0859-8217; HMW, 0000-0001-6450-8266;...

the building up exceed the waste, then the animal grows ; if the waste ex4. HANDBOOK OF PHYSIOLOGY. 8 and if decay go on beyond a certain becomes...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QE, UK SJB, 0000-0002-4410-2960 Real-world complex networks are composed...

which receives the Proc. Condyloid. Maxillae Infer., and therefore is more ex4. cavated than the superior surface. FIG. The Dorsal Vertebrae and four...

Engineering Mathematics and Physical Sciences, University of Exeter, Exeter EX4 4QF, UK 2 Faculty of Engineering, and 3 Nanoscale and Microscale Research...

the uterus ; for, were it ' 6 not juft, it would be contradided by daily ex4 perience. But the matter no longer refts up♦ 4 on the foundation of opinion...

to embark on his second voyage; no difficulty was found in equipping the ex4 OnAP. I. COLU3fEUS. S pedition. ' The public favour,` of which he nu...

not have his bees run him." ; It is equally adapted to the producer of ex4. tracted honey. While it is true that in raising extracted honey, swarming...

seldom did the pastor return home from these social gatherings decidedly ex4 THE HOUSE OF HARPER Temperance societies were as yet unheard of, likewise...

Second. ; — — portions. As far as possible, surface water should be ex4. Third. cluded from the foundation-bed, and all possibility of running water...

sixty-four short essays on important themes, symbolically and enigmatically ex4. Book These cabala pressed, based on linear figures and diagrams. are held...

autho­ although fallacious opinions may rities. have been once completely ex4. * Report of Board of Education, 1847-48, p. 13G. f Mr. Willoughby’s Minute...

and disintegrated portions. As far as possible, surface water should be ex4. Third. cluded from the foundation-bed, and all possibility of running water...

A-S5 \ex4. AMERICAN STANDARD OF EXCELLENCE SOUVENIR OF FIRST FTJITION Buffalo, New York, lanuary 15-18, 1674 ALBERT R. MANN LIBRARY New York ...

and that he himself knew little or nothing bf Chinese ?4' The colloquial ex4 * When Fourmont received from Father.Premare his Translation of the Orphan...

(a) The rose? (b) The leaf? (c) The teacup? (d) The knife? (a) A moving ex4. Can you form a visual image of (b) Your sharpening of a pencil? (c) An press...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4RJ, UK Asian School of the Environment, Nanyang Technological University...

be a careful survey of the assets, the liabilities, the income, and the ex4. Ordinarily what is penses, in order that the auditor as a "test may...

swell- distinguished by its hardness. ing Pain is the result of increased ex4. of the nerves, at first, owing to citement exalted nutrition of the part...

minister who has adopted this Basis, but does not deem it expedient to sever ex4 : ' ' — : own request, be enChurches desiring to take action isting...

every sort of manual labor. masses of the people, unlettered stupidity, ex4. Among the thrumming and twanging on the guitar, attuning and tinkletankling...

cards. The analysis and punching of accidents will be simple. Taking, for ex4. ample, accidents referable to policy year 1918. The companies during 1918...

folarfpotshe exprefleshil:nfelfthus: 's Htc materianullc ea rpI)eiRevaporatioet ex4'halatio(quiaaliulldeminimeoriripoteIl3qllx ex 44-ipfocorporef<>lis, utfwprac>-llellfurn...

Ounces 4 with his Hands, nor hold a Pen to 4 write withal, in which he before ex4 celled. To this Youth various Re4 medies having before been given 4 without...

and axes of the conical figures belonging to the species are compared by ex4 pressing the measures of them in millimeters. The specimens being very often...

rule sha11 apply to the POSltlons- officers. Title 45 45-Secotities and Ex¬ Ex4. Assignment of excepted em- a"d employeesof the offices affected, and Title...

heeded by all who love freedom. Tor our own part we take this opportunity of ex4 plaining our hearty delight at the suppression Protestant Chapel at Rome...

kind of goods. What is meant? Using money seems to lengthen the process of ex4. change by making tzn'o operations necessary where before one sufficed. How...

on low grounds in Ontario. It flowers in June. Plate VI. ^6««-''4--ex4£^ Jack-in-the-pulpit . I'kolu — h . t [iitK. 20 Arrow Arum {Peltandra...

comfort and a benefit to them. Those who were buried at Camp Hamilton, ex4* HISTORY OF THE 42 cepting one, were interred beneath a large willow...

abdomen. 3. Line of direc- men tion for the diaphragm when relaxed in ex4. Line of direction when conpiration. tracted in inspiration. 5, 6. Position...

i <S^A0A<gAvA^^ Tens I | I &A/xa/vtZXy(iw Hu rta r e a. s (|MO^{EX4 tDvAr vV^^ / o FIG. 31. low resistance, it would practically be short...

power to feed, ", MA- 04 , and:. govern the . Catholic church, as it. is ex4 " 4 plained in the seta of the CEcumenicaI Councils, and in the " Holy Canons...

or reject as they chose; but the government has taxed these bills out of ex4. which istence. — 82. Bill of Indictment. A written accusation against...

Beli, the Palace or Court of Belinus,' was a structure in Lud's Town, which ex4 tended over the Broken Wharf . into the city, till it approached the Gateof...

to deepen in which certain tendons work, as the tendons of the peronei, ex4. and render smooth the grooves tensors of the thumb. Also forming the...

distribution in small lots Furnishes manufacturers with a sales force 3. Ex4. Education of the retailers 5. Makes small community stores possible ; Services...

the liquid water intd the solid rock, the'deep ocean into dry land, and ex4 tends the dominions of man, Who sees it not and knows it not, over regions...

their light and impalpable nature renders them only the more diffieult of ex4/ tirpation. A cursory review and refutation of these popular prejudices...

and courage, whom I have feen born and die, and who fet us fo many good ex4 l amples did we but mind them.’ 5 B 2 B. iii. c. 9. fwarmed OBSERVATIONS...

into July Article VI and jects of this Treaty, is it 3, same was ex4, 1827. By provided that the sub- citizens of the contracting parties...

the Bourbons, or any Prince of that family, on the Th even Ancase of the ex4 tinetiox oftheImperial ¢ asty: Marae g either theancient feudal nobility...

Otete Gee ets rt st : ‘4 hh att CMa ths bed hat os ies hii iets ex4 a. CLA ae mths! rs 3 af, % a} } wee atttt wad a he mi im\ . zt...

Conference again unanimously confirmed it by the adoption of confirmatory and ex4. 1830 pository resolutions. 6. That no other part of our Discipline has...

guard against ers and sisters. making too much of this distinction, and ex4 ELDEST SISTER. 3S pecting too account of much deference to be paid to...

，1 IB?. s: 呆麻 ^ 調 偷錄 木翦花 醉花 fe5 卜& 二领 -酔. J^tH? 一 w EX4 ^9VJJ r 匕 雙：^ 望 id 南 ss 花 御^ izN? ^■^Rfi^:^^^ 窗 "湿^ ^^a^vvv^^K^:;^...

(a) The rose? (b) The leaf? (c) The teacup? (d) The knife? (a) A moving ex4. Can you form a visual image of (c) An (b) Your sharpening of a pencil? press...

EMPOUEI, TOUUO[~ITON, E- INSCRIPTIONS. EANIAI, 'TEUEI, and also EX4>YUE, refusals to assimilate, as in PIO, TPONB[IXO], cation of as in...

Each of the above articles they deem ‘ to be a grievance, they having been ex4 arnined, approved, and admitted to prac4 tile phyfick without limitation...

Company, 4. Halt; or, 3. Full step, Guide (right or left). 62. file-closers ex4. Maroli, At the second command, the right guide stands right front rank...

obtained, is alfo greater. Add to this `that howfoever the multitude might feel ex4 el!ence, or ' the 'contrary, in the works of the' 'painter -or ' yntrfician...

particular Habits of Body, it general4 ly caufes great Diforders. Befides, if Ex4 perience [ 43 ] € * 4 c 1 * * c perience and Authority are to be appealed...

That there may be 3 credited to this appropriation, to be available until ex4 pended, funds received from States, counties, municipali5 ties, other public...

many branched, forming a Scales entire. (C. vestlta^ Erackenridge, U. S. Ex4 to 8 inches high. lowish-brown. tangled mass. pedition.) From the Yosemite...

.................. 40 % 4) other ............................. 30 % ex4) kippered herring, canned in oil of the same fish or in tomato sauce, kipper...

reddish orange: Mrs. S. X. Murdock.- (Dorner & Son.) Improvement over any ex4»t*a^-%en©Mi light rose or pink; good size and substance. Certificated at...

quintuplo) longioribus; stigmatibus ovarium cum stylo ajqui-longo aequantibus ex4. J. Brkweri, ca^spitosis ; sertis ; capsula .... near Monterey,...

Condition ' of his Affairs was fuch, that he could not anfwer his and their Ex4 peEtation. The Duke of Bohan treks to the French King for a Peace. . The...

endeavoured t show that any attempt to make railways to an extraordinary ex4 the Flesh of Animals as Food...... 419 Court and Aristoc1 . 415 The Metropolis...

same direction. There is a curiously regular progression of distance (ex4. pressed by Bode's law, which, however, breaks down at Neptune). 5. There...

making it taut. With knife (15) hand (16) forward on scrotum (10) and ex4 inches. The right incision (13-14) incision (11-12) well tending backward...

That there may be 3 credited to this appropriation, to be available until ex4 pended, funds received from States, counties, municipali5 ties, other public...

aanguinc diapewtioa gave Vo his conversatum a peculiar charm. Hit raillery was ex4|uiaite.*^ Morning CkronicU, Mr Canning’s attention to his mother speaks volumes...

remind the Porte of what ing the past few day* by the United (Mate# she may ex4>eet. TIM IIRALY. nn«l Great Britain Independently, and the Russian government...

bit error probability is e 21bNo ~exP[P11 P= 2= 1 (4.7) F-A'T1 ] =- ex4 where E,, /N, is the signal energy to noise ratio. The expression for Y...

Prom the Premifes it appears, that the 4 People of God may (and do well to) ex4 ercife the like Government upon the like 4 occafions: For what proved good...

when it does not require a large dwelling-place, and becomes more and more ex4 tended to suit the growth of its inmate. c When 18 INSECT MANUFACTURES...

superior and inferior 3°. recti, acting against each other, by only about ex4". Feigned blindness of one eye may often be posed by means of the diplopia...

AND SONS. > H m W < H W < H P-i iJ fi •J. < ffi O O o S w p H o Ex4 w w H H W in Ui pi w pH D w p< a > tlj w K H O t* O o Z < i i I...

1 Centre for Research in Animal Behavior, University of Exeter, Exeter EX4 4QG, UK Research Centre for Anthropology and Health, Department of Life Sciences...

— Start! or Begin Description of Exercise. The fingers are flexed and ex4. tended with arm or forearm in any of the positions. Arm, Forearm, Hand...

this tape-recorded discussion by E. W. Aiton, Director, Division, Federal Ex4-H and YMW tension Service; G. H. Huffman, Assistant Administrator, FES;...

Edinburgh, EH10 4AX Exe Bridges Retail Park, Alphington Street, Exeter EX4 1AH St Nicholas Gate Retail Park, Carlisle CA1 2EA Bricklayers Arms, Mandela...

of wire, and lifting the bar into the direction of the dipping needle, he ex4 cited by a current in the coil. On reversing current in the opposite direction...

and opening a paffage into the cylinder, and by fitting a valve to the ex4. ternal overture of the other. The inftrument, thus prepared, being...

gear of all kinds. 7. The authorization of responsible person to conduct ex4. perimental fishing. 8. Provisions for the sale of fish and apparatus....

Edinburgh, EH10 4AX Exe Bridges Retail Park, Alphington Street, Exeter EX4 1AH St Nicholas Gate Retail Park, Carlisle CA1 2EA Bricklayers Arms, Mandela...

employee's domestic affairs. 4. The secondary wage is remuneration for any ex4 ceptional gifts or qualifications, not of the individual but or employee...

God will have his iustiee satisfied : and therefore • CATECHETICAL EX4:aCISES. Q. 12.] wo must make by or this fall satisfaction, either 27...

engine of four horses’ power. Mr. James Cumimg, North Street, exhibited ex4 -raits. This Apparatus consists of a small clock, yith two indices, the longer...

fortitude, and to an assump-t tion of the panoply of God, imply a constant ex4 posure to " dangers "• on every side. .Why • is, Christ called .a Saviour...

Litc-gua d. • -.- All Syftem in general p All the Bodies afore-mentioned, ex4 cept the Sun, are called (||) PlanetsRanees, (which Word in the Greek Language...

Psychology, University of Exeter, Washington Singer Building, Perry Road, Exeter EX4 4QG, UK CA, 0000-0001-9809-1630; CDC, 0000-0001-6058-4114 Subject Areas:...

quippe cornea vel adnatae ipsi incumbentis ulceribus ab externo peresa, vel ex4»udata inter lamellas eius vesicae in raodum distenditur, et nip\iriformi...

regiment by 44 flank. There was probably a de44 lay of two or three minutes in ex4 4 ecuting that movement, I spoke, 44 then, to the General, and said: 44 ‘General...

(railways, steamships, etc.), communication (telegraph and telephone), and ex4. change. 5. tunes, For a tax on incomes and inherited forpublic rights...

the faithful Subjedls of our faid Lord 6 the King, to perfuade, move and ex4 cite, to take up Arms, and to levy 6 and make War within this Realm, a4 gainfi:...

establishing contact between the Turks and the Allies the conferera?e . is~.ex4>ected-ti>. pssform « -vaht— able service, but it is not anticipated that...

factum multi inter illog & cordatiores valde dolent. Gratias tibi ago pro ex4 emplaribus tractatus de tolerantio, & pace ecclesiastica, quae mihi. misisti...

Salisbury Dwarf.. 9. Early Dutch 10. Early Wakefield 11. Early Winningstadt (ex4. tra fine) 4 . „ 4l „ f< it it Heale's Early Imperial.. 13. EarlyBattersea...

Treatment for Portion of Gain on Sale of Condominium Units Converted From Ex4. No Gain Recognized From Net Before March 31, 1981 C. Disaster Loss Deduction...

dorrldsxmlw adalloluRroaad Hit -xa1A1 arra3adaz oHls.di3 11£a¡do3I 4u,° aV ¡ex4.4, o 4.ROH 0910 lYi' im ra RH 9130 d9110 aduaaV ado He '¡E1Y9£ed odeaerE...

auetori- Rurfus , fi ex ipßi ßpe aviditate äugend* feien* animi ajfenfum ante ex4' tut in errores dilabimur, velob praeipitem menperaßum:vel ifiarum reruw...

the giant race of Yatudhana. 6. By Praskanwa. O Agni, prepare here an ex4 ^ As supplying them with rain, for their nourishment. ^ In the original...

omnes, qui haffenus eum veluti u trutina expenderunt, &c.” Page 91. “ This Ex4£ preffion is particularly remarkable —“ Newtonus 46 hoc argumentandi modovidetur...

The hogs develop good constitutions with considerable strength and are in ex4. cellent condition for quick fattening feed after coming out of the field...

illustrate. 3. What's the difference between long meter and short meter? Ex4. What should be the qualities of a good style? plain and illustrate the terms...

AS WELL AS IN OTHER COUN urvonom OF 'MINCE, ritiLs. A II/STORY OF FAIR EX4.1111,E, AND OF GREAT P1101.71' JO 711E. FRENCH, B zinnia(' at 'Le Year we(...

the Regifters of 4 the Roy al Soci et y ; together with all my Inventions, Ex4 periments, Difcoveries, Difcourfes, &c. which I have made, the 4 time when...

Respect for Relics authorised by Scripture. 3. Virtue reverence for them ex4. possessed by Saints' Relics. A 5. Shown by the first Christians. emplified...

parents have been inherited. If 10 percent have really superior qualities, the ex4 years, A library serves plorations will be considered highly Natural...

DM-EX2 State effects DM-EX3 Discuss kinds of physical activity. DM-EX4 Discuss time and frequency of physical DM-EX5 Discuss simple ways to measure...

the Historia del Reinado de Carlos III. en Espana, por A. Ferrer del Rio. Ex4. Revista Espanola de Ambos Mundos, i\Iayo de 1855. 2. from the article El...

chapter 2003 of 3 title 54, United States Code, including administrative ex4 penses, and for acquisition of land or waters, or interest 5 therein, in...

College of Life and Environmental Science, University of Exeter, Exeter EX4 4QD, UK JMC-R, 0000-0003-2794-2914; LC, 0000-0003-3001-983X; KLS, 0000-0002-9581-268X...

Property Office to the Department of the SL.y 1M?4 r use, admmistration, or ex4 iower Yellowstone project Notices: Vested property; intention to ier the...

by,;,the Vomit 9cif Kid& 'Renck-41100043 , of MrI. 1KnaxeshorQugh'.14is ex4 traorain#44:1 triairm•SentenseA. ton death, lint ttianspeutted.. ASb84)-4$101114QtaitY...

terms of such agreed settlement, and . shall be accompanied by a report of ex4. By amending section 60.2401 so as The regulations adopted by the United...

Malice ; and therefore let it not be 4 marvelled, if they fometimes prove ex4 cellent Perfonsa as was Agifdaus, Zanger 4 the Son of Solomon, Efop} Gafca...

text—" I have a message from GOd unto thee."* My auditory consisted almost ex4 chisively of farmers arid .their families ; and I have seen' feir t onntricongregations...

theniklves.' His lordfhip adds, ' Her majelly is very fenfible of the concern you ex4 prefs for her honour, and will not, you may be lure, ' litfrer herfelf to...

130 3. Relatively temporary chemical (?) differences in water used in ex4. 5. perimental tank Occurrence of negatively 131 reacting individuals...

Lympha defiled with Excrementitious * Humours, not fufficiently feparated and ex4 pelled by Urine, Stool, Sweat, &c. So c that the Sanguineous and Lymphatick...

submitted to the governor. A charter was granted to the Nine, but their ex4 In 1653 there was more than the istence was shortlived. usual amount of...

sink in™ to it % hut causes it to assume its orig¬ inal smoothness aiT-ex4 the wheel has •passed* in ay he considered as a term of* surface fxiction...

national sovereignty, the United States, besides agreeing to respect aU ex4^ WT f30fi)000 f30d>00° or $400,000 *400,000 annuaEy annually as Efe Me annuities...

of 44: 154. used as no;<e ornament 31: 53. Abbe, Prof. Cleveland, eclipse ex4: 125. plained to the Indians by Abbes, H. 46: 367. 1 : 338. key to 30:...

had been impoverished by the city, and was unable to give the child as ex4 Nor was he pensive an education as he had desired. in his own wise if an...

1690, as before, A and ditto Sixpence, Jan. 1689, grained edges, both ex4 tremely fine, rare 2 From the Pixley Cabinet. 23 James II, Pattern Sixpence...

t^ be w(bedj that fame of us utould more afplji our endeavourt ufitv the ex4» tnination •fthefe old epimmf,which though thtyhAVefor 4 long time lien...

deze Lotery zullen de penningen voor de The Managers will use their utmost ex4— aanverkochte loten ontvangen en daarvoor ertions, not alone to get purchasers...

Ifchiadisrernedium U ari 634 'fint Hyena & lupo gigni , 7$ I oleum ex4 11 lunipcii ligno uaherc crocutarci L T AbrorurrifiiTuras fana- re...

duobusnubcrct, An vnusduasvxoreshabcrct, quade re Macrob.Saturnai.lib. i .capuJ. Ex4«aisigiturRcgibus,Tarquinio,rciliccc',fupcrbo,cVali;s f qui polt eum fucuri...

favorable balance oh These agreements, in effect, granted a favorable Argentine ex4 change rate in reciprocation to countries applying trade with most of these...

])hilanthropv which will so speedily reduce our taxes, reduce our prison ex4. To penses, reduce the expense of institutions for correction and reform...

(a) The rose? (b) The leaf? (c) The teacup? (d) The knife? (a) A moving ex4. Can you form a visual image of press train? (b) Your sharpening of a pencil...

•THE KINGDOM OF FRANCE, AS WELL AS IN OTHER COUNTRIES. A HISTORY OF FAIR EX4.111 )I E, ANn OF GREAT PROFIT TO THE FRENCH, m Ginning a the Year NI ...

Iron and Steel Association, thongh his ideas concerning the Institute are ex4 ceedingly misty, couldn’t have said that about it, at ever so late an hour...

hecho fobre que fe litiga . ^ Dizefe que no ha cumplido D. Antonio con la ex4 hibicion dé las cartas,pues debiendo fer hada el año dé <i5p.n0 llegan las...

subscriptions from house in her hand, passing to house. I think her ex4 - GRACE KING. 31 ample would have provoked them to similar exertions...

tice) a luxuriant growth of maize in the nei°h- a* th,e, gr'3U“d’ gr'3mid’ n,ex4 “or“i“& “1,ornl“6 lo, and behold! the mob, headborhood of London, springing...

not kill." xxxn ; therefore, let by Aaron had made them a molten calf (Ex4, 10. and the Lord said to Moses, "Now, me alone, against them, and that...

baritone. lie's dead now, and it won't harm him to tell tho story, provided Ex4 ' i Come and see me, I'll trate ye dacent, make yc drunk, and I'll All...

deficiency in receipts. The incoam for the past five moijtbs has been in ex4|83 of the corresponding months of 1867. Vhe Summer mouths, however, yield...

who published £ it in an imperfect form, under the pretext that the matter ex4 eluded would have been subject to the English law of libel. Two 4 results...

Postmaster or Deputy Postmaster violate this section, he shall bo fined, not ex4 any book or other writing- ceeding two hundred dollars. The point raised...

WESTERN HEMISPHERE By general co-operation in turning the present period of ex4. clusion of Americans from Europe into a time of special international travel...

of Psychology, University of Exeter, Washington Singer Building, Exeter EX4 4QG, UK 3 Department of Experimental Psychology, Ghent University, Henri...

be w(bedj that fame of us utould more afplji our endeavourt ufitv the ex4» tnination •fthefe old epimmf, which though thtyhAVefor 4 long time lien...

Biosciences, University of Exeter, Geoffrey Pope Building, Stocker Road, Exeter EX4 4QD, UK Department of Plant Sciences, University of Oxford, South Parks Road...

~i" X-.'.2m" Again,sinceE -1 = 1 and tions such as x .. a+bx4^cvx+drx +ex4 }' ?- s_ I l, 'Z ). ' = l; and aby+cyl+dy3+Ey4 )- = becauseno analyticalexpressionor...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4RJ, UK RER-M, 0000-0002-1383-1108; LA, 0000-0002-5726-7238 Subject Areas:...

slippery; hence their it ; 20 and easy separation from other bodies. 3. Ex4. Perfectly transparent. 5. Hard, rigid^ tremely fluidity, solid. duct indexible...

1920-21, $61.12) in Northumberland, to 20 pounds, 17 shillings (par, $101.47; ex4 shillings, the figures varying, according to the district, change 1920-21...

the sides are lighter than in H, its width The upper extremity of the stem ex4^2. to the left of the light right side of the central spur is half-way...

assimilations of N, l<, and r, as in EMPOUEl, TOUUOn^TON, E^ITEUEI, ES- 2:ANIAI, EX4)YUE2;, MEAXPY^A, EAMME, and also refusals to assimilate, as in X:^YNMAXOI...

gencratimaccipis dequacunque be nedi&ione, qtiam Chriftus adhibuit pani & fic itcrum ex4. ; tra /copum vcldeea fpeciatim, fit mentio in Euangeho 6c non re&e loqueris...

extent fnX^ Lve^onwauMtlv mt of the claims school. Most of our fnnds „ r been ex4 xU u •» ’ ■• i, *x » upon them. We wish, however, il 1. »x k.i, tl xl.>v...

upon the Subject. The papers, when delivered to the Member of the Board of Ex4. aminer appointed by the Council to examine upon the Subjectyare to be by...

'JO. 18 $16.00 $150 $1.70 produced. Medium size, light salmon color and of ex4 feet, budded, branched 20.00 .25 2.20 ISO 'oo cellent quality. 5 feet, budded...

outrag«-s have Insu executed by being shotin the Wick. The anarchists recently ex4*cut»d oetalde of Montjuicb were the last batch of friends, guilty of throwing...

contineri docuit, quid, quaefo, hisce verborum formulis aliud pbiiofophi veteres ex4) Diogen, ib. L. VIII. 76. p-538- et Tennem, p. 2455) Diogen. ib. L. IX...

locum inveniunt. Utrinque euodem Autorem,Teftem, aliave fiéîa Judicem ex4>e£tari oportet. Hic Ignis in cœlis TerrisVie probabit opera noftra, aurone...

sisters. But you must guard against making too much of this distinction, and ex4 38 ELDEST SISTER. pectirig too much deference to be paid to you on account...

University of Exeter, Hatherly Laboratories, Prince of Wales Road, Exeter EX4 4PS, UK SCP, 0000-0001-5362-3330 Received: 8 February 2017 Accepted: 4 May...

40-014 - 0-55 + 0-040+ 0-27 40*014-0-25 Mean K = R + 0-03941grain. Mean D=Ex4 0-01405grain. Beforeany use can be made of theseweighings,the resultsmust...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QD, UK 3 HR Wallingford, Howbery Park, Wallingford OX10 8BA, UK Received:...

Ministerului Invàtä miintultd Public Se declarä, de utilitate publicä i se ex4 Art. unic. propriazi in favoarea Statului, imobilul situat in BlIC114 resti...

re- facultate incft, infit habilem reddat. rcligionc pcr fcripVeriim, ex4 perficit. turam revelata excolit VI. Scio quid hic praetendere ligioni revelatae...

BO80eta. per doe., enterr <1oa. ; WE MAKE EEr AUCTION SALE Heavy FightLug Ex4-»- UvL. tin western frontier with!* 48 hour». It Cor. Tate* rnd Broad «create...

interest. : —All of our trees and plants are quoted in named sizes; for ex4 to 6 feet and not as “Planters Grade, “Double XX,” or “Mail Sizes,” etc....

Research in Animal Behaviour, Psychology, University of Exeter, Exeter EX4 4GQ, UK 2 Game and Wildlife Conservation Trust, Burgate Manor, Fordingbridge...

“There Was slight artillery activity at various points along the front, ex4 cept In the direction of Dlxmudo and Boeslnghe, where the bombardment was...

told you, 4 that he heard, when he was here, that you were likely to be ex4 cepted out of the general act of pardon and oblivion and, tho' I 4 know not...

under this act, to 3 declare any dividend when die debts of the company ex4 ceed their solvent credits. 2 3 4 5 6 7 8 9 10 11 12 V. Be it further enacted...

4-1 < CO r~ 4-1 — CO CO u CJ 3- 1/0 oE a Qu cj oj u •H HH EX4 iJ i 00 c z QJ X I/O i 1 **J I/O i c HH CO | Ex] C 1 co...

Mathematics & Physical Sciences, University of Exeter, Stocker Road, Exeter, EX4 4QL, UK Received 2019 May 21; revised 2020 January 8; accepted 2020 January...

city of London at phcal CollecJuftice,. Mercy, and Mortification are fully ex4 St Mary le Bow 26 July 1685, being the day of pub- tions » No' *• Publiihed...

ad Wafconingawallam, hoCT ee e ie. BOLaAOU aie uvium,, in Bononefo , fram.Ex4 prefliohati 4 PATRONZA GHISTELLENSIUM. 5 preffiores patria generis S....

the Duke, it was Impoffible for her to 4 live any time with a load of fuch ex4 quifite grief. 4 Lady Jane foxne time after this return4 ed to London, leaving...

_i Y 0A _Ab,- ~ -M-Ii -a A0u0 f L At f T1 - ItANJ go443 m, ,EX4 m~ 931,113 I 1313 No. 443 AZML ~ q 1958 Nationss Unies - a A140 VI...

lanterns, and threw a large mat in the centre of the garden, and dusted it ex4 THE STORM DANCE travagantly with rice flour. Then a shaft of light...

luriiisued w iib «-arnages and horses, on short 1 it doired. with cai«*ful and ex4»ero*ne«*«l i ua reasonable terms as at any other cslab- o! public patronage...

crops on good ashes. farm land. They store up on the roots of plants the ex4. cess nitrates which the plant does not use. This is done in the form of...

for a winter shell bean. 2 oz. pkt. shell bean for baking, soups, etc. By ex4 cts.; y2 pint 10 cts.; quart 38 cts. You express, 3 quarts or over, 22 cts...

College of Life and Environmental Sciences, University of Exeter, Exeter EX4 4QG, UK 2 Subject Category: Psychology and cognitive neuroscience Subject...

distiti- 6iiiF. guished her two 'sons, William • and John, — Lord, Stowell , Ex4.' and Lord F4.lon. Their destiny was materially influenced by the chivalrous...

Saepe eandem vim habet ac t. pn^jniusy ut Lys. I, 2: ,,]Non enim virtute sui ex4. ercitus, sed immodestia factum est adversariorum^', quem locum explicare...

venter corum. Saturati funt fijiis ; quias fuas parvulis fuis. i/me, k ex4, Egoautemin peftui tuo falvos : mcj Te me, umde- lare II in Ltus...

the related isometric mixing pressure, needed to reproduce the present ex4 perimental mole fraction of He in liquid nH at 20 K for P/P'' = 10. With...

been sworn and examined in chief; but in some jurisdictions he may be cross-ex4 In a majority of the jurisdicamined if he has been merely sworn. tions in...

insured loans, 3 $9,279,000, of which $1,252,000 is for administrative ex4 penses, as authorized by the Indian Financing Act of 5 1974: Provided, That...

avenue, Glendale. Covers were laid |sicians were in agreement in their ex4 1 7 B ra n d B lv o .. G l e n d a l e . C a _. for ten. After dinner the...

manifeftum eft, cur, durante mola4 rium eruptione, quam inciforum, magis ex4 cruciantur infantes/ Sic enim habet celeber, Van Swieten. 4 Omnia dentitionis...

Chas. Jules Francois, ------ the M i— * --lion *------■-*- a-------— -•of—ex4 able to promise the documents on this alia* Count de Neufchaleau, who was...

excellent thing tD exclude the air from such things as are injured by being ex4 of a pound posed to it. DEPARTMENT. DRUGGISTS' — Arnica Liniment Add...

ea Inaintea adjudearate tribunalului preteaeatiunii tiunile lor, sub 1*de:ex4 de a nu U se Mai tine in seami. Nr. 379. 1047, lanuarie 23. Do6. 14.109437...

qualifications of the Surgeon 8 and Physician Bell (Charles) on the Anatomy of Ex4 pression in Painting 8 Engravings of the Arteries System of Operative Surgery...

change their principles, but not digeftlve fait and gypfum. Nos. i . — 20. ex4 b lb lt 24 On EîeBive AttraEîïons. hibit the iingle, 21.— 40. the double...

oats. sorghum grain. Farm sales weight; exports; declared weight. Exports ex4/ Production: clude Soviet bloc and communist China whose exports are estimated...

i We thy poor 4 Creatures by thy Grace met together in this Place, by an ex4 traordinary means in the darknefs of the night and in a linl* 4 Houfe, to...

Happy life, national &quot; Phineas Arms, at the age of seventeen to ex4 THAT FORTUNE change in a moment the tedium of the cornfield for immortality...

ни:квююпа* A t-ib п р в и а т е х ъ Гос. ,^ м Ф п р азн ап .' р . ппилриаи n « ia ex4 . . л ...* лату проевть адреса ямиераторт съоб*' выборы второго разряда нзбнужтелей...

its color yet introduced. Stems are remarkably long stems. large and of ex4 JEANNE CHARIIET. A decorative variety of Flowers are very exquisite form...

lowest rates Broad arrested Matteo Fajaro, the m*y<W' of Tlie anarchy that ex4*ts all m-er Al­ WANTED—At once, Z000 coal oil cans aad A. Robertson A Son...

quinque; Si (quod omnino fe a ligamehtis vertebrarum dotfi. Ab necefl'eeft)ex4.i*f.<^4. conjunxeris feptem illos humeri,fex fcapula:, &qua- r ^ hish.exbrla...

ego ſeci uobis, Laus h}! ita & uos Faciatis. Hoc tanto ſanéìae humilitatis ex4 m-ſi‘m‘“ ' ‘ emplo,eoqz ſermonis , quo opus hoc ita pium iuxtaj ac ſalutare...

defired, he was the more * folicitous for getting him difcharged. And this Ex4 aminant faith, that during the whole Time of Hum4 phries's Examination, (being...

incifioni, e concauità laterali Amile , come dice Fefto,yfc appellatum , quod ex4 vtroque lettere ejjet recifum , *vt fummum , infimumque eius latius medio...

projects that could contribute to cost and schedule variance due to unknowns. EX4 Lake Okeechobee Regulation Schedule (LORS) EX5 Priority Change Priority...

Infpiratio magna eit; frigidum 4 enim aerem ad refrigerationem defiderant: Ex4 fpiratio vero parva ; nam veluti igne exufta ul4 cera cum fmt, a calido praeterea...

Drepturile rezervate activitatea societätii. adunirilor generale ordinare i ex4 Numirea lor se va face prin de- traordinare se vor exercita de Mbi ciziune...

proprietarii salt exploatatorii de paduri, contrar prevederilor din autorizatia de ex4 ploatare, plata amenzilor se va face conform prevederikr codului silvic in...

when jf a is therefore to be fung fharp 9 the fix Notes lye as in thefe Ex4 amples. i^lliiiiiiiiiiiiii ^iillilliliiii |pii~ . >ir*~"< I. 2. J...

early and very prolific bloomer SNOW. A beautiful pure white, long stem. Ex4 cellent for cutting This variety SALMON QUEEN. Buff salmon, rounded and...

we have made. 7 Ogle 9 it is not my duty DeKalb as temporary Chairman to ex4 Peoria DeWitt 12 tend my remarks. I ask jour assistance in 5 Perry 3 DuPage...

conscience s’an- noncent autrement que la haine ou le remords. Ces différentes ex4 5o ( ) pressions qui se peignent dans nos ou les altèrent d’une manière...

4>ri'oi-M defect, when of the same kind or variety aii4l oiiii8Mi4>iiM ; an4l no ex4;epti4»ii as anything named in the list; in sucli'a will l»4> uia4l4' t4»...

They will be the penitentiary walls showed hew be bad - Canada, wjth thc-ex4^ptIon. of- <mi*-loue—friendly- rivalry: in all niUllary - mailT^pot; IWr...

lonffaenrefloit de (èpt pouces il confcrvoit fa mefm% ^'ofTeur juiqucs à fon ex4 & vers l'anus. tremitc. Il efloit fort îî ^ p:. r ca?»: t , &...

linton-Meyi-rs Co,, own.Ts of the E.ri-eum The*, icr. and the eiiy Duluth. Ex4>erta from aU over tin- Northwest are here to establish the cl.i tus tif tile...

sion, same noun; as, a tall, high tree. Be careful to use the word that ex4. presses the exact meaning you intend to convey. 5. Punctuate your sentences...

yet-- YZX*ite.*i^Ti,ig:y~yx^ ' /iZazf îZî/, ^^yrti_y~zylcx^ zr /i/i^ex4.^-^niy<nx^ âLyf*ici4.^-/cnt ^CZaz —P~^y> û/y^e/àx^ àlZpyÿ^ez^£ixex^ y y^tCZltf...

Is it to the extent known by the general laws of Europe? Or is it to the ex4 nt ,of tbe .iurt*diction in the English admiralty in-tsonly! This is a leading...

letanciens temps, a la multiplication des colonies, c'est celii.:i .des.ex4 piations. Les princes on particuliens queavaient. commis quelque crime ,...

Engineer i Allowance 2 Resident Engineer 3 Commuted Travelling Allowance and Ex4 penses . . . . .. Cadet, 6 months at £150,6 months at £250 5 Commuted Allowance...

check, provided you have money in the bank to pay it. for By freight or ex4 - lb., 15c; y2 -lb., 20c; lb., 40c. press, at purchaser’s expense, pkt.,...

national bank wks thrown down pythe- vio- ~ lence oC the cunvusston,- when the ex4 plosion «jeeurred. 11 The second fire was believed to ,h^v« been checked...

twelte or paid aftraiilotia and thirty or more cotH-e^ahaia. rate only. Ex4*!u4i4e under canras offered. offera. A. T NKKLY, I’realilenl. Ala¬ mu.^t...

aide ur elkvwhere in preference to *nhtnttirg to the iuconv•■•nience of the ex4*a*tle foç Ascot llenth shortly h«*fore I Orange River Colony men *nr- triiordiDary...

hand. Th l*)V* *hould receive » -rotts- man's feature* were compared with a EX4)M-B FHOM BXTRNMOX. rtf ibe time you naturally become Inactive, the shipyard...

melena de fus coronados dzos, la íixaré, 4... vueftro Eftanckttc, Señor, g)ex4 por mas fuilofos que llegan, en viendome, íe reparan, Rf ifeo, en feguro...

ex-al-zar, ex-a-ge-rar, ex-i-mir, ex-a-iaen, ax- !G' io-ma^éx-i-to^ex-i-guo, ex4-mio, ex-ac-to, exi-gir, ex-o-ne-rar, ex- or-dio, in-ex-o-ra-blCí re-loji...

Flores k vimin^a theca erum- guit . Varia columna; fegmcnta-». p?incs*Poit ex4^am hemem m 6$ Ordo dabtformam, 77 pium. . Veritas exmendacio Coliegium...

Solumdt's Diatoni. - Atlas. SS5 ATLAS o DEK DIATOMACEEN-KÜNDE -<o>ex4«s IN ^o |e ,J VERBINDUNG MIT DEN HERREN GRÜNDLER, GRUNOW, JANISCH,...

effodere operarios iubent , in 'vir^neofolo , 'vt tpfi aiebant ,* ^ ex4; Kom^ ibique^^ feptem3 cum eorum admiratione Scarith eruuntur : Florentiam...

and I'll take care of Murty and his masther, Con. Take —— How ! (ex4'f, R. e. ! THE HA UNTED Man. {goes to {pouting) forgot to window...

iuftitiam fubuertere. /. objeruattdum.jf.de tudit . 2Vec qnicquam permtttitur 1>ex4 tiDanjs ¡umptibus coram diuerfis iudicibus . ditt.l.nulli, cap. i . extra...

splendid bedder ._. 10 *Belle Alliance. Large, sw eet scented, scarlet flower; ex4.50 42.00 .65 cellent Purple 10 Cerise Gris de Lin. cerise white, bordered;...