Share to:

CXCL2

CXCL2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1QNK

Identifikatori
AliasiCXCL2
Vanjski ID-jeviOMIM: 139110 MGI: 108068 HomoloGene: 105490 GeneCards: CXCL2
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za CXCL2
Genomska lokacija za CXCL2
Bend4q13.3Početak74,097,040 bp[1]
Kraj74,099,196 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za CXCL2
Genomska lokacija za CXCL2
Bend5 E1|5 44.78 cMPočetak91,039,100 bp[2]
Kraj91,040,974 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 vezivanje za proteine
CXCR chemokine receptor binding
cytokine activity
chemokine activity
Ćelijska komponenta extracellular region
Vanćelijsko
Biološki proces chemokine-mediated signaling pathway
response to molecule of bacterial origin
response to lipopolysaccharide
Hemotaksija
positive regulation of neutrophil chemotaxis
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
regulation of cell population proliferation
cell chemotaxis
defense response
inflammatory response
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
cytokine-mediated signaling pathway
neutrophil chemotaxis
leukocyte chemotaxis
cellular response to lipopolysaccharide
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002089

NM_008176

RefSeq (bjelančevina)

NP_002080

NP_032202

Lokacija (UCSC)Chr 4: 74.1 – 74.1 MbChr 5: 91.04 – 91.04 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Hemokinski ligand 2
Identifikatori
SimbolCXCL2
Alt. simboliSCYB2, GRO2, GROb, MIP-2a, MGSA-b, CINC-2a
NCBI gen2920
HGNC4603
OMIM139110
RefSeqNM_002089
UniProtP19875
Ostali podaci
LokusHrom. 4 q21
Pretraga za
StruktureSwiss-model
DomeneInterPro

Hemokinski ligand 2 (X-C motiv) jest mali citokin koji je kod ljudi kodiran genom CXCL2 sa hromosoma 4. Pripada porodici CXC hemokina koja se također naziva makrofagni inflamatorni protein 2-alfa (MIP2-alfa), protein beta reguliran rastom (Gro-beta) i Gro onkogen- 2 (Gro-2). CXCL2 je 90% identičan u sekvenci aminokiselina kao srodni hemokin, CXCL1.

Ovaj hemokin luče monociti i makrofagi i ima hemotaksije za polimorfojedarne leukocite i hematopoetske matične ćelijee.[5][6][7] Na hromosomu 4, gen za CXCL2 nalazi se u grupi drugih CXC hemokina.[8] CXCL2 mobilizira ćelije, interakcijom sa ćelijskom površinom preko hemokinskog receptora koja se naziva hemokinski receptori (CXCR1 i CXCR2.[7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 107 aminokiselina, а molekulska težina 11.389 Da.[9]

1020304050
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQ
GIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKM
LKNGKSN

Funkcija

CXCL2, kao i srodni hemokini, također je moćan hemoatraktant neutrofila i uključen je u mnoge imunske odgovore, uključujući zacjeljivanje rana, metastaze raka i angiogenezu.[10] Studija je objavljena 2013. testirajući ulogu CXCL2, CXCL3 i CXCL1 u migraciji glatkih mišićnih ćelija disajnih puteva (ASMC), što ima značajnu ulogu u astmi. Rezultati ove studije pokazali su da i CXCL2 i CXCL3 pomažu u posredovanju migracije normalnnih i astmarskih ASMC-a kroz različite mehanizme.[10]

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000081041 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029380 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wolpe SD, Sherry B, Juers D, Davatelis G, Yurt RW, Cerami A (januar 1989). "Identification and characterization of macrophage inflammatory protein 2". Proceedings of the National Academy of Sciences of the United States of America. 86 (2): 612–6. Bibcode:1989PNAS...86..612W. doi:10.1073/pnas.86.2.612. PMC 286522. PMID 2643119.
  6. ^ Iida N, Grotendorst GR (oktobar 1990). "Cloning and sequencing of a new gro transcript from activated human monocytes: expression in leukocytes and wound tissue". Molecular and Cellular Biology. 10 (10): 5596–9. doi:10.1128/mcb.10.10.5596. PMC 361282. PMID 2078213.
  7. ^ a b Pelus LM, Fukuda S (august 2006). "Peripheral blood stem cell mobilization: the CXCR2 ligand GRObeta rapidly mobilizes hematopoietic stem cells with enhanced engraftment properties". Experimental Hematology. 34 (8): 1010–20. doi:10.1016/j.exphem.2006.04.004. PMID 16863907.
  8. ^ O'Donovan N, Galvin M, Morgan JG (1999). "Physical mapping of the CXC chemokine locus on human chromosome 4". Cytogenetics and Cell Genetics. 84 (1–2): 39–42. doi:10.1159/000015209. PMID 10343098. S2CID 8087808.
  9. ^ "UniProt, P19875" (jezik: engleski). Pristupljeno 23. 10. 2021.
  10. ^ a b Al-Alwan LA, Chang Y, Mogas A, Halayko AJ, Baglole CJ, Martin JG, Rousseau S, Eidelman DH, Hamid Q (septembar 2013). "Differential roles of CXCL2 and CXCL3 and their receptors in regulating normal and asthmatic airway smooth muscle cell migration". Journal of Immunology. 191 (5): 2731–41. doi:10.4049/jimmunol.1203421. PMC 3748335. PMID 23904157.


Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya