Share to:

KRAS

KRAS
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4WA7, 1D8D, 1D8E, 3GFT, 4DSN, 4DSO, 4EPR, 4EPT, 4EPV, 4EPW, 4EPX, 4EPY, 4L8G, 4LDJ, 4LPK, 4LRW, 4LUC, 4LV6, 4LYF, 4LYH, 4LYJ, 4M1O, 4M1S, 4M1T, 4M1W, 4M1Y, 4M21, 4M22, 4NMM, 4OBE, 4PZY, 4PZZ, 4Q01, 4Q02, 4Q03, 4QL3, 4TQ9, 4TQA, 4DST, 4DSU, 5F2E,%%s2MSC, 2MSD, 2MSE

Identifikatori
AliasiKRAS
Vanjski ID-jeviOMIM: 190070 MGI: 96680 HomoloGene: 37990 GeneCards: KRAS
Lokacija gena (čovjek)
Hromosom 12 (čovjek)
Hrom.Hromosom 12 (čovjek)[1]
Hromosom 12 (čovjek)
Genomska lokacija za KRAS
Genomska lokacija za KRAS
Bend12p12.1Početak25,205,246 bp[1]
Kraj25,250,936 bp[1]
Lokacija gena (miš)
Hromosom 6 (miš)
Hrom.Hromosom 6 (miš)[2]
Hromosom 6 (miš)
Genomska lokacija za KRAS
Genomska lokacija za KRAS
Bend6 G3|6 77.37 cMPočetak145,162,425 bp[2]
Kraj145,195,965 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
LRR domain binding
GDP binding
GO:0032403 protein-containing complex binding
GTP binding
GMP binding
GO:0001948, GO:0016582 vezivanje za proteine
GO:0006184 GTPase activity
vezivanje identičnih proteina
Ćelijska komponenta citoplazma
citosol
membrana
focal adhesion
extrinsic component of cytoplasmic side of plasma membrane
ćelijska membrana
mitohondrija
Lipidni splav
Biološki proces visual learning
GO:1904089 negative regulation of neuron apoptotic process
response to mineralocorticoid
positive regulation of protein phosphorylation
regulation of long-term neuronal synaptic plasticity
regulation of protein stability
epidermal growth factor receptor signaling pathway
positive regulation of MAP kinase activity
cytokine-mediated signaling pathway
negative regulation of cell differentiation
stimulatory C-type lectin receptor signaling pathway
response to glucocorticoid
MAPK cascade
axon guidance
Fc-epsilon receptor signaling pathway
positive regulation of nitric-oxide synthase activity
forebrain astrocyte development
endocrine signaling
positive regulation of NF-kappaB transcription factor activity
homeostasis of number of cells within a tissue
striated muscle cell differentiation
Ras protein signal transduction
epithelial tube branching involved in lung morphogenesis
regulation of synaptic transmission, GABAergic
actin cytoskeleton organization
leukocyte migration
GO:0072468 Transdukcija signala
positive regulation of Rac protein signal transduction
GO:1901313 positive regulation of gene expression
positive regulation of cell population proliferation
ERBB2 signaling pathway
liver development
positive regulation of cellular senescence
female pregnancy
response to isolation stress
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004985
NM_033360
NM_001369786
NM_001369787

NM_021284

RefSeq (bjelančevina)

NP_004976
NP_203524
NP_001356715
NP_001356716
NP_004976.2

NP_067259
NP_001390169
NP_001390170
NP_001390171
NP_001390172

NP_001390173
NP_001390174
NP_001390175

Lokacija (UCSC)Chr 12: 25.21 – 25.25 MbChr 6: 145.16 – 145.2 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

KRAS (skr. od eng. Kirsten rat sarcoma virus = Kirstenov virus pacovskog sarkoma) je gen daje upute za stvaranje proteina zvanog K-Ras, koji je dio RAS/MAPK puta. Protein prenosi signale izvan ćelije do ćelijskog jedra. Ovi signali upućuju ćeliju da raste i dijeli se (razmnožava) ili sazrijeva i preuzima specijalizirane funkcije (diferencira). K-Ras protein je GTPaza, što znači da pretvara molekulu koji se naziva GTP u drugu molekulu koji se naziva GDP. Na ovaj način protein K-Ras djeluje kao prekidač koji se uključuje i isključuje pomoću molekula GTP i GDP. Za prijenos signala, mora se uključiti pričvršćivanjem (vezivanjem) za molekulu GTP -a. Protein K-Ras se isključuje (inaktivira) kada pretvara GTP u BDP. Kada je protein vezan za BDP, ne šalje signale u ćelijsko jedro.

Zove se kao eng. skraćenica KRAS jer je prvi put identificiran kao onkogen u Kirstenov pacovski virusni sarkom.[5] Virusni onkogrn je izvedenica ćelijskog genoma. Prema tome, gen KRAS u ćelijskom genomu zove se protoonkogen.

Genski proizvod je prvi put pronađen kao p21 GTPaza.[6][7] Kao i drugi članovi potporodice ras, KRAS protein je GTPaza i rani je učesnik na mnogim putevima transdukcije signala. KRAS je obično vezan za ćelijske membrane, zbog prisutnosti izoprenske grupe na svom C-kraju. Postoje dva proteinska produkta gena KRAS u ćelijama sisara koji su rezultat pojave alternativnog egzona 4 (egzona 4A i 4B): K-Ras4A i K-Ras4B; ti proteini imaju različitu strukturu u svom C-terminalnom području i koriste različite mehanizme za lokalizaciju na ćelijske membrane, uključujući plazmamembrane.[8]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 189 aminokiselina, a molekulska težina 21.656 Da.[9].

1020304050
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQI
KRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ
RVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM
Simboli

Funkcija

KRAS djeluje kao molekulski prekidač za uključivanje/isključivanje, prateći dinamiku proteina. Nakon što se alosterno aktivira, regrutira i aktivira proteine potrebne za razmnožavanje faktora rasta , kao i drugih ćelijskih signalizacijskih receptora poput c-Raf i PI 3-kinaza. KRAS smanjivanje i povećava djelovanje GLUT1 transportera glukoze, doprinoseći tako Warburgovom efektu u ćelijama raka.[10] KRAS se veže za GTP u svom aktivnom stanju. Također ima intrinzičnu enzimsku aktivnost, koja cijepa terminalni fosfat nukleotida, pretvarajući ga u BDP. Nakon pretvaranja GTP -a u GDP, KRAS se deaktivira. Stopa konverzije je obično spora, ali se može dramatično povećati dodatnim proteinom iz klase GTPaza-aktivirajući proteini (GAP), naprimjer RasGAP. Zauzvrat, KRAS se može vezati za proteine klase guanin-nukleotidnog faktora razmjene (GEF) (kao što je SOS1), što prisiljava oslobađanje vezanog nukleotida (GDP). Nakon toga, KRAS veže GTP prisutan u citosolu i GEF se oslobađa iz ras-GTP.

Ostali članovi porodice Ras su: HRAS i NRAS. Svi ovi proteini regulirani su na isti način i izgleda da se razlikuju po mjestima djelovanja unutar ćelije.

Klinički značaj mutacija KRAS-a

Ovaj proto-onkogen je Kirstenov ras onkogeni homolog iz porodice sisarskih gena ras. Zamjena jedne aminokiseline, a posebno jedna nukleotidna supstitucija, odgovorna je za aktiviranje mutacije. Transformirajući protein uključen je u različite maligne bolesti, uključujući adenokarcinom pluća,[11] mucinozni adenom, duktusni karcinom pankreasa i rak debelog crijeva.[12][13]

Utvrđeno je da je nekoliko zametnih linija KRAS-ovih mutacija povezano s Noonanovim[14] i kardio-facio-kožnim sindromom.[15]

Somatske mutacije KRAS-a nalaze se u velikom brzinom u leukemijama. kolorektalom karcinomu,[16] raku gušterače[17] raku pluća.[18]

Testiranje KRAS-a

U julu 2009. godine, Američka agencija za hranu i lijekove (FDA) ažurirala je oznake dva anti-EGFR monoklonsko antitijelo, lijekova naznačenih za liječenje metastatskog kolorektalnog karcinoma, panitumumab (Vectibix) i cetuximab (Erbitux), kako bi uključili informacije o KRAS mutacijama.[19]

U 2012., FDA je također očistila QIAGEN-ov teraskrin KRAS test, genetički test dizajniran za otkrivanje prisutnosti sedam mutacija u genu KRAS u ćelijsma kolorektalnog karcinoma. Ovaj test se koristi za pomoć ljekarima u identifikaciji pacijenata s metastatskim kolorektumskim karcinomom za liječenje Erbituxom. Prisutnost KRAS mutacija u tkivu raka debelog crijeva ukazuje na to da pacijent možda neće imati koristi od liječenja Erbituxom. Ako rezultat testa pokaže da KRAS mutacije nisu prisutne u ćelijama raka debelog crijeva, tada se pacijent može razmotriti za liječenje Erbituxom.[20]

Kao cilj lijeka

Mutacije pokretača u KRAS-a temelj su patogeneze do 20% ljudskih karcinoma.[21] Stoga je KRAS privlačna meta lijeka,ali nedostatak očiglednih mjesta vezivanja ometao je razvoj lijekova.[22] Jedno od potencijalnih mjesta interakcije lijekova je mjesto gdje se veže GTP/GDP. Međutim, zbog izuzetno visokog afiniteta GTP/GDP za ovu lokaciju, malo je vjerojatno da bi se inhibitori slični lijekovima malih molekula mogli natjecati s vezanjem GTP/GDP. Osim na mjestima gdje se veže GTP/GDP, ne postoje očigledna mjesta vezanja visokog afiniteta za male molekule.[23]

Interakcije

Pokazano je da KRAS komunicira sa:

Reference

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000133703 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000030265 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Tsuchida N, Ryder T, Ohtsubo E (1982). "Nucleotide sequence of the oncogene encoding p21 transforming protein of Kirsten murine sarcoma virus". Science. 217 (4563): 937–939. doi:10.1126/science.6287573. PMID 6287573.
  6. ^ Scolnick EM, Papageoege AG, Shih TY (1979). "Guanine nucleotide-binding activity for src protein of rat-derived murine sarcoma viruses". Proc Natl Acad Sci USA. 76 (5): 5355–5559. doi:10.1073/pnas.76.10.5355. PMID 228228.
  7. ^ Kranenburg O (novembar 2005). "The KRAS oncogene: past, present, and future". Biochimica et Biophysica Acta (BBA) - Reviews on Cancer. 1756 (2): 81–2. doi:10.1016/j.bbcan.2005.10.001. PMID 16269215.
  8. ^ Welman A, Burger MM, Hagmann J (septembar 2000). "Structure and function of the C-terminal hypervariable region of K-Ras4B in plasma membrane targeting and transformation". Oncogene. 19 (40): 4582–91. doi:10.1038/sj.onc.1203818. PMID 11030147.
  9. ^ "UniProt, P01116". Pristupljeno 11. 8. 2021.
  10. ^ Yun J, Rago C, Cheong I, Pagliarini R, Angenendt P, Rajagopalan H, Schmidt K, Willson JK, Markowitz S, Zhou S, Diaz LA, Velculescu VE, Lengauer C, Kinzler KW, Vogelstein B, Papadopoulos N (septembar 2009). "Glucose deprivation contributes to the development of KRAS pathway mutations in tumor cells". Science. 325 (5947): 1555–9. doi:10.1126/science.1174229. PMC 2820374. PMID 19661383.
  11. ^ Chiosea SI, Sherer CK, Jelic T, Dacic S (decembar 2011). "KRAS mutant allele-specific imbalance in lung adenocarcinoma". Modern Pathology. 24 (12): 1571–7. doi:10.1038/modpathol.2011.109. PMID 21743433.
  12. ^ Hartman DJ, Davison JM, Foxwell TJ, Nikiforova MN, Chiosea SI (oktobar 2012). "Mutant allele-specific imbalance modulates prognostic impact of KRAS mutations in colorectal adenocarcinoma and is associated with worse overall survival". International Journal of Cancer. 131 (8): 1810–7. doi:10.1002/ijc.27461. PMID 22290300. S2CID 27328214.
  13. ^ Krasinskas AM, Moser AJ, Saka B, Adsay NV, Chiosea SI (oktobar 2013). "KRAS mutant allele-specific imbalance is associated with worse prognosis in pancreatic cancer and progression to undifferentiated carcinoma of the pancreas". Modern Pathology. 26 (10): 1346–54. doi:10.1038/modpathol.2013.71. PMC 4128625. PMID 23599154.
  14. ^ Schubbert S, Zenker M, Rowe SL, Böll S, Klein C, Bollag G, van der Burgt I, Musante L, Kalscheuer V, Wehner LE, Nguyen H, West B, Zhang KY, Sistermans E, Rauch A, Niemeyer CM, Shannon K, Kratz CP (mart 2006). "Germline KRAS mutations cause Noonan syndrome". Nature Genetics. 38 (3): 331–6. doi:10.1038/ng1748. PMID 16474405. S2CID 8193354.
  15. ^ Niihori T, Aoki Y, Narumi Y, Neri G, Cavé H, Verloes A, Okamoto N, Hennekam RC, Gillessen-Kaesbach G, Wieczorek D, Kavamura MI, Kurosawa K, Ohashi H, Wilson L, Heron D, Bonneau D, Corona G, Kaname T, Naritomi K, Baumann C, Matsumoto N, Kato K, Kure S, Matsubara Y (mart 2006). "Germline KRAS and BRAF mutations in cardio-facio-cutaneous syndrome". Nature Genetics. 38 (3): 294–6. doi:10.1038/ng1749. PMID 16474404. S2CID 28915489.
  16. ^ Burmer GC, Loeb LA (april 1989). "Mutations in the KRAS2 oncogene during progressive stages of human colon carcinoma". Proceedings of the National Academy of Sciences of the United States of America. 86 (7): 2403–7. doi:10.1073/pnas.86.7.2403. PMC 286921. PMID 2648401.
  17. ^ Almoguera C, Shibata D, Forrester K, Martin J, Arnheim N, Perucho M (maj 1988). "Most human carcinomas of the exocrine pancreas contain mutant c-K-ras genes". Cell. 53 (4): 549–54. doi:10.1016/0092-8674(88)90571-5. PMID 2453289. S2CID 22457575.
  18. ^ Tam IY, Chung LP, Suen WS, Wang E, Wong MC, Ho KK, Lam WK, Chiu SW, Girard L, Minna JD, Gazdar AF, Wong MP (mart 2006). "Distinct epidermal growth factor receptor and KRAS mutation patterns in non-small cell lung cancer patients with different tobacco exposure and clinicopathologic features". Clinical Cancer Research. 12 (5): 1647–53. doi:10.1158/1078-0432.CCR-05-1981. PMID 16533793.
  19. ^ OncoGenetics.Org (juli 2009). "FDA updates Vectibix and Erbitux labels with KRAS testing info". OncoGenetics.Org. Arhivirano s originala, 9. 11. 2014. Pristupljeno 20. 7. 2009.
  20. ^ FDA: Medical devices: therascreen® KRAS RGQ PCR Kit – P110030, accessed 20 Jone 2014
  21. ^ Cox AD, Fesik SW, Kimmelman AC, Luo J, Der CJ (novembar 2014). "Drugging the undruggable RAS: Mission possible?". Nature Reviews. Drug Discovery. 13 (11): 828–51. doi:10.1038/nrd4389. PMC 4355017. PMID 25323927.
  22. ^ Ryan MB, Corcoran RB (novembar 2018). "Therapeutic strategies to target RAS-mutant cancers". Nature Reviews. Clinical Oncology. 15 (11): 709–720. doi:10.1038/s41571-018-0105-0. PMID 30275515. S2CID 52897928.
  23. ^ Holderfield M (juli 2018). "Efforts to Develop KRAS Inhibitors". Cold Spring Harbor Perspectives in Medicine. 8 (7): a031864. doi:10.1101/cshperspect.a031864. PMC 6027934. PMID 29101115.
  24. ^ a b Li W, Han M, Guan KL (april 2000). "The leucine-rich repeat protein SUR-8 enhances MAP kinase activation and forms a complex with Ras and Raf". Genes & Development. 14 (8): 895–900. PMC 316541. PMID 10783161.
  25. ^ Kiyono M, Kato J, Kataoka T, Kaziro Y, Satoh T (septembar 2000). "Stimulation of Ras guanine nucleotide exchange activity of Ras-GRF1/CDC25(Mm) upon tyrosine phosphorylation by the Cdc42-regulated kinase ACK1". The Journal of Biological Chemistry. 275 (38): 29788–93. doi:10.1074/jbc.M001378200. PMID 10882715.
  26. ^ Rubio I, Wittig U, Meyer C, Heinze R, Kadereit D, Waldmann H, Downward J, Wetzker R (novembar 1999). "Farnesylation of Ras is important for the interaction with phosphoinositide 3-kinase gamma". European Journal of Biochemistry. 266 (1): 70–82. doi:10.1046/j.1432-1327.1999.00815.x. PMID 10542052.
  27. ^ Spaargaren M, Bischoff JR (decembar 1994). "Identification of the guanine nucleotide dissociation stimulator for Ral as a putative effector molecule of R-ras, H-ras, K-ras, and Rap". Proceedings of the National Academy of Sciences of the United States of America. 91 (26): 12609–13. doi:10.1073/pnas.91.26.12609. PMC 45488. PMID 7809086.
  28. ^ Vos MD, Ellis CA, Elam C, Ulku AS, Taylor BJ, Clark GJ (juli 2003). "RASSF2 is a novel K-Ras-specific effector and potential tumor suppressor". The Journal of Biological Chemistry. 278 (30): 28045–51. doi:10.1074/jbc.M300554200. PMID 12732644.
  29. ^ Villalonga P, López-Alcalá C, Bosch M, Chiloeches A, Rocamora N, Gil J, Marais R, Marshall CJ, Bachs O, Agell N (novembar 2001). "Calmodulin binds to K-Ras, but not to H- or N-Ras, and modulates its downstream signaling". Molecular and Cellular Biology. 21 (21): 7345–54. doi:10.1128/MCB.21.21.7345-7354.2001. PMC 99908. PMID 11585916.

Dopunska literatura

  • Kahn S, Yamamoto F, Almoguera C, Winter E, Forrester K, Jordano J, Perucho M (1987). "The c-K-ras gene and human cancer (review)". Anticancer Research. 7 (4A): 639–52. PMID 3310850.
  • Yamamoto F, Nakano H, Neville C, Perucho M (1985). "Structure and mechanisms of activation of c-K-ras oncogenes in human lung cancer". Progress in Medical Virology. Fortschritte der Medizinischen Virusforschung. Progrès en Virologie Médicale. 32: 101–14. PMID 3895297.
  • Porta M, Ayude D, Alguacil J, Jariod M (februar 2003). "Exploring environmental causes of altered ras effects: fragmentation plus integration?". Molecular Carcinogenesis. 36 (2): 45–52. doi:10.1002/mc.10093. PMID 12557259. S2CID 23937262.
  • Smakman N, Borel Rinkes IH, Voest EE, Kranenburg O (novembar 2005). "Control of colorectal metastasis formation by K-Ras". Biochimica et Biophysica Acta (BBA) - Reviews on Cancer. 1756 (2): 103–14. doi:10.1016/j.bbcan.2005.07.001. PMID 16098678.
  • Castagnola P, Giaretti W (novembar 2005). "Mutant KRAS, chromosomal instability and prognosis in colorectal cancer". Biochimica et Biophysica Acta (BBA) - Reviews on Cancer. 1756 (2): 115–25. doi:10.1016/j.bbcan.2005.06.003. PMID 16112461.
  • Deramaudt T, Rustgi AK (novembar 2005). "Mutant KRAS in the initiation of pancreatic cancer". Biochimica et Biophysica Acta (BBA) - Reviews on Cancer. 1756 (2): 97–101. doi:10.1016/j.bbcan.2005.08.003. PMID 16169155.
  • Pretlow TP, Pretlow TG (novembar 2005). "Mutant KRAS in aberrant crypt foci (ACF): initiation of colorectal cancer?". Biochimica et Biophysica Acta (BBA) - Reviews on Cancer. 1756 (2): 83–96. doi:10.1016/j.bbcan.2005.06.002. PMID 16219426.
  • Su YH, Wang M, Aiamkitsumrit B, Brenner DE, Block TM (2005). "Detection of a K-ras mutation in urine of patients with colorectal cancer". Cancer Biomarkers. 1 (2–3): 177–82. doi:10.3233/CBM-2005-12-305. PMID 17192038.
  • Domagała P, Hybiak J, Sulżyc-Bielicka V, Cybulski C, Ryś J, Domagała W (novembar 2012). "KRAS mutation testing in colorectal cancer as an example of the pathologist's role in personalized targeted therapy: a practical approach". Polish Journal of Pathology. 63 (3): 145–64. arXiv:1305.1286. doi:10.5114/PJP.2012.31499. PMID 23161231. S2CID 17666526.

Vanjski linkovi

Content Disclaimer

Informasi ini disarikan dari Wikipedia dan disajikan kembali untuk tujuan edukasi. Konten tersedia di bawah lisensi CC BY-SA 3.0. Kami tidak bertanggung jawab atas ketidakakuratan data yang bersumber dari kontribusi publik tersebut.

  1. The information displayed on this website is sourced in part or in whole from Wikipedia and has been adapted for the purpose of restating it. We strive to provide accurate and relevant information, however:
  2. There is no guarantee of absolute accuracy. Wikipedia is an open, collaborative project that can be edited by anyone, so information is subject to change.
  3. It is not intended to constitute professional advice. The content displayed is for informational and educational purposes only. For important decisions (e.g., medical, legal, or financial), please consult a professional.
  4. Content copyright. Wikipedia is licensed under the Creative Commons Attribution-ShareAlike License (CC BY-SA). This means that content may be reused with appropriate attribution and shared under a similar license.
  5. Responsible use. Any risk arising from the use of information from this website is entirely the responsibility of the user.
Prefix: a b c d e f g h i j k l m n o p q r s t u v w x y z 0 1 2 3 4 5 6 7 8 9

Portal di Ensiklopedia Dunia

Kembali kehalaman sebelumnya